SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000018521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000018521
Domain Number 1 Region: 1141-1414
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.08e-41
Family C5 cytosine-specific DNA methylase, DCM 0.0069
Further Details:      
 
Domain Number 2 Region: 6-103
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.42e-28
Family Calponin-homology domain, CH-domain 0.0000864
Further Details:      
 
Domain Number 3 Region: 811-941
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.03e-26
Family PWWP domain 0.0000717
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000018521
Domain Number - Region: 1038-1109
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00023
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000018521
Sequence length 1420
Comment (Oryzias latipes)
Sequence
MAGTEAVLVKWLNNLLKTNFQEVQEMSSGACYCQIMDCTIPGSIDLAKVKFDAQCEDDYK
HNFTLLQEAFKKQGITEGIPVEELIQGDIKTNSEFLKWFKIFHLTSKNQKAVKNNRDISP
NPASPPPRTYEMPSSWNGRSPSGNSRQDLGTEKNNLVATGKGSLYTEKWKETFDWAERST
LGDDYTFCTSCQSNLHTINKGLVELQRHSETKKHKKGTNLYEGNNSQNKTTKLPCSDAAL
RFIRSRSNFAPMNGEKPSKHFLYRTLGRRYPKDIASVCRHTPYCVYVYEEVSVGKDQHVS
VMLVGFYDLQTAAHSVRFLDAFESESGDQTASYVFQTLEKFELPAENLAAVYVSGDSQLS
AQICSELRKLNPILISIGPLYSIADAACCAGVKKLSGLVQELLSALEEQYFSSSIQSDEL
EALLDSVYDEKSSTSFLDIGCLKFCRLISKILEMWTDLTRHFSSRNDEEAELICSQLKDP
KVKATFLFLRKALKPLQKFQTQTLEDSWTSMLLILKEASSLLSTYTSCFLQQSAAARYLE
EHDARILRSKKSLLSSPDLDLGGNEVEDALRACDEPAALPHFCEQALSFYAALTGCIAEE
LPLSVKALRSIAQLLSPQSWLKVTSAQVKELGTQLGVCNSTDEIRQLTEEFLECKPTREV
GPHAGTTVDSLKQHWSRLLDGAKPASLFRRLVLTLLSLPCPPLDPKQVLSRVLETTEASS
DEESTDSSCDTSCSRKDISIHSPHVQNPQIIQINSINTGDLNSSRCTSSLVNLTLHPFQD
WSTIYCNQVKLGEERPHSGKHTPTKVQRKHNYQDGKGFPVGDLVWGRVKSLSLWPGMVIP
WKSKSSPVGMRRVEWFGDGMISETNTEGLLPFSTFSKSFCKNSYASLPMYKKAIYEILEL
AAERSRKSFADAEGDKEKELKLMLEWAFEGFLPTGPEGFAPPSMFSSGFSVQKEPSEISE
DYPPKKRKYLSKNRTSTSAVTCNRESLIEMIKEPGKTIEDFCLSCSSTEVDVQHPLFEGG
LCLRCKENFSETLYRYDEDGYQSYCTVCCAGLEVVLCDNVNCCRCFCKDCLNILIEDGTF
EKLRDTETWNCFMCTPSQCKGNLQLRPDWSVRVQDFFANSSALEFEPHRVYPSIPVAERR
PLKVLSLFDGIATGYLVLKHLGFKIERYIASEICDDSIAVGMIKHEGKIEYVNDVRTITR
KHLAEWGPFDLLIGGSPCNDLATVNPNRKGLYEGTGRLFFEFYRILNLLRPREEDNRPFF
WLFENVVHMNSRDKTDICRFLECNPVLIDAIDVSPAHRARYFWGNLPGMSRRVATSLDDK
VNLQDCLEIGRVAKFDKVRTITTKTNCMRQGKTGQLPVIMNGKDDSLWCTEMELIFGFPK
HYTDVNNMSRMQRQRVLGRSWSVPVIRHLLAPLKDYYACE
Download sequence
Identical sequences H2MIN9
ENSORLP00000018521 ENSORLP00000018521 8090.ENSORLP00000018521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]