SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000019662 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000019662
Domain Number 1 Region: 1373-1511
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.59e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000108
Further Details:      
 
Domain Number 2 Region: 217-308
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000458
Family Calponin-homology domain, CH-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000019662
Sequence length 1514
Comment (Oryzias latipes)
Sequence
DHYDFTRAKISCSLTWLVAKAFGSDVVPEELAEPLYKDQYNQEHLKPPVACLLQSAELYC
RAGSLILRSDAVKPLVGHNAVIQALAQKGLYVTDQYRLVTERDLMSTPIHMSSHLALIDT
LMMAYAVEMVSAERVMSCINRFSSPEPLHSEALFQELPYDTEDAIVTWINKVIEQLRDVL
VEEQRLKEASLQEANSTTHKTRYRREHAQRSTPSLPLVENLLKDNADGCALTALLHFYCP
EAVRLEDICLKETMSLADSLYNLQLVQEFCRNNLNHCCHFSLEDMLYAHPSIKSNYQVFM
AELFWWFEVVKPSFVQPRVVNPNVCEATSSCGEAVPVSSPIKQSYADRPSGQSHTQLRDE
FLTNCRNNTGIFLNQHNPNQMTTGNAFSKMIRVGIQKIKKIYFNQLPGEMRRSSSMSFVD
GCAGTWPKGKHSSSRGISFEIPLVGDPELLPCEAPSACGMSRSASSDSLGFKVHYAAKGG
MKRQLSATPVSVNGQHIPEEDEDFTPQKPLGRNNTFSIKNQNRCRENKSQIFFFESNWIS
DLKFLRHNYKNVITSSHNFNKNIQKNVVKRHMSPSTPPSIEEALKIIHDTERPHASFGVG
DNSFFLHGVEPSPPSGAQAPEDVPVSAKAHLHDRDPNSASTDEVDTGIHVRTEDIQSLDE
DSSSLRDYSDIDPDWEAMTRSCPLPVRQEQSRDAVGEANPDGQKGTGGDRGSPCASSAPT
LPRSHTLSPASSVGGSGGGLVRMTSFAEQKFRKLEGRSSGGTTPDSSDLNVPYTHKPVSS
QFSTPPLPITSSVAPSPRDPSHLIASEMIQLRMKLEEKRRAIEAQKKKVEAAFTRHRQKM
GKTAFLNIVKRKGVTAPPSAGGAAAPSLDSSERSTQRSVEQTESQIVVNQEQRDKCYSEI
LQTNRSIYVFIFLSEAKNGIIIIKRTLGTLCSKDRSLEGVAPGEADLAEYTRSIERLNTS
LGFLQTEMQRLALQQEKIMAMQLRELRSSSVTSRGSGRGSVGSLSPVLSSYGSPRATSQA
PAGIKRRPASFHARTPRTPRPNDLKVTSFSRMLNTPTSVDSLPRLRRFNPSQTQTSPFAY
LGPNKDSAKSKEEPLLNAGESAKEKEVELQEERAESKGDVPQPDTADVLQQPVQSNTGSQ
VQGEAQERGDLVEVSLSELKPPEVVAEGETGELYREDQKMCCGFFFKDDAKEEKDMAAKK
AALLEKRLRREKETQEKKQQQELDQEQKKEAARLKAEEGQQRKDEDKARMDFIKNECMRR
KQLKLMEDMDEVIKPRSGSLKKKPRPKSIHRDVMESSVPSVRLTGVRPRGFSVSSVSLAS
LNLADNDKDQSDNRKNSRPDSTEGFSSCPSAGSRNGEKDWENDSTTSSTPSNTEYTGPKL
YKEPSAKSNKHIIQNALAHCCLAGKVNEGQKNKILDEMEKSEANNFLVLFRDSGCQFRSI
YTYCPETEEMTRLAGIGPKSITPKMIEALYKYNSDRKQFSQIPAKTMSASVDAITIANHL
WQIKKQGTPKKHPK
Download sequence
Identical sequences H2MLS8
ENSORLP00000019662 8090.ENSORLP00000019662 ENSORLP00000019662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]