SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000020711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000020711
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.09e-45
Family Calponin-homology domain, CH-domain 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000020711
Sequence length 298
Comment (Oryzias latipes)
Sequence
MSTHFRSGPAFGLSAEVKSKLASKYDPQKEEELRMWIEDVTGKQMGDNFMESLKDGVILC
ELINVLQPGSVRKVNHSNQNWHQLENIGNFVRAITEYGLKPHDIFEANDLFENVNHTQVQ
STLIALAGMAKSKGFHSKYDMGVKYAEKQQRRFAPEKLREGRNIIGLQMGTNQFASQKGM
TSYGTRRHLFDAKIGMDNPIDQSTISLQMGTNKGATQAGMTAPGTRRHIFDKKLELENCD
TTTISLQMGTNKVASQQGMTTYGLPRQVYDNKYCANPTEGFYNNGSEVEFDGYNQYSD
Download sequence
Identical sequences H2MPP8
ENSORLP00000020711 8090.ENSORLP00000020711 ENSORLP00000020711 XP_004072036.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]