SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000021661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000021661
Domain Number 1 Region: 1205-1315
Classification Level Classification E-value
Superfamily E set domains 4.2e-35
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 2 Region: 1399-1510
Classification Level Classification E-value
Superfamily E set domains 2.87e-32
Family Filamin repeat (rod domain) 0.0000246
Further Details:      
 
Domain Number 3 Region: 1307-1414
Classification Level Classification E-value
Superfamily E set domains 3.74e-32
Family Filamin repeat (rod domain) 0.0000269
Further Details:      
 
Domain Number 4 Region: 933-1023
Classification Level Classification E-value
Superfamily E set domains 1e-30
Family Filamin repeat (rod domain) 0.00000713
Further Details:      
 
Domain Number 5 Region: 2-118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.08e-28
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 
Domain Number 6 Region: 2092-2187
Classification Level Classification E-value
Superfamily E set domains 4.27e-28
Family Filamin repeat (rod domain) 0.0000127
Further Details:      
 
Domain Number 7 Region: 620-744
Classification Level Classification E-value
Superfamily E set domains 5.4e-28
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 8 Region: 1114-1226
Classification Level Classification E-value
Superfamily E set domains 7.34e-28
Family Filamin repeat (rod domain) 0.00000891
Further Details:      
 
Domain Number 9 Region: 1713-1814
Classification Level Classification E-value
Superfamily E set domains 8.67e-28
Family Filamin repeat (rod domain) 0.0000283
Further Details:      
 
Domain Number 10 Region: 341-446
Classification Level Classification E-value
Superfamily E set domains 2.8e-27
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 11 Region: 545-640
Classification Level Classification E-value
Superfamily E set domains 4.07e-27
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 12 Region: 252-350
Classification Level Classification E-value
Superfamily E set domains 5.35e-27
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 13 Region: 1904-1996
Classification Level Classification E-value
Superfamily E set domains 1.16e-26
Family Filamin repeat (rod domain) 0.0000269
Further Details:      
 
Domain Number 14 Region: 439-543
Classification Level Classification E-value
Superfamily E set domains 5.67e-25
Family Filamin repeat (rod domain) 0.00013
Further Details:      
 
Domain Number 15 Region: 1026-1138
Classification Level Classification E-value
Superfamily E set domains 1.93e-24
Family Filamin repeat (rod domain) 0.000047
Further Details:      
 
Domain Number 16 Region: 2193-2284
Classification Level Classification E-value
Superfamily E set domains 2.94e-24
Family Filamin repeat (rod domain) 0.0000223
Further Details:      
 
Domain Number 17 Region: 1500-1611
Classification Level Classification E-value
Superfamily E set domains 8.67e-24
Family Filamin repeat (rod domain) 0.0000561
Further Details:      
 
Domain Number 18 Region: 733-838
Classification Level Classification E-value
Superfamily E set domains 1.13e-23
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 19 Region: 2415-2505
Classification Level Classification E-value
Superfamily E set domains 2.4e-23
Family Filamin repeat (rod domain) 0.0000176
Further Details:      
 
Domain Number 20 Region: 2286-2376
Classification Level Classification E-value
Superfamily E set domains 8.01e-22
Family Filamin repeat (rod domain) 0.0000212
Further Details:      
 
Domain Number 21 Region: 850-948
Classification Level Classification E-value
Superfamily E set domains 2.01e-21
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 22 Region: 169-266
Classification Level Classification E-value
Superfamily E set domains 4e-21
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 23 Region: 2015-2107
Classification Level Classification E-value
Superfamily E set domains 2.54e-19
Family Filamin repeat (rod domain) 0.0000994
Further Details:      
 
Domain Number 24 Region: 1821-1916
Classification Level Classification E-value
Superfamily E set domains 7.34e-19
Family Filamin repeat (rod domain) 0.0000378
Further Details:      
 
Domain Number 25 Region: 1655-1734
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000187
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000021661
Sequence length 2506
Comment (Oryzias latipes)
Sequence
DSKAIVDGNLKLILVWTLILHYSISMPMWDGEDEEAESKTPKQRLLGWIQNKVPDLPITN
FSQDWRDGRALGALVDSCAPGLCPDWETWDSVKPVDNATEAMQLADDWLGIPQAQMSEML
MFFGFSSFSIKLYFNKNIWSKRVKKDKYLKKKSNLKMDRSFCLGIEPTGNRVLRPAVFTV
DTFSAGQGQVTVYLDHPDGTREELKAEPNEGKKTLSVTYIPQVMGPHKVTVLFAGQQIPK
SPFEVNVDKALGDASKVTVKGPGIEPVGNIANKPTYFDIFTAGAGTGDVTAMVRDPQGRQ
NSVEVMMEDKGDSVYRCTYRPTLPGPHTVSVTFGGVGVPRSPFTVDVGPACTPGACRATG
RGLQPSGLRVEQVGDFRVDTRNAGSGDLKVFIKGPKAAEEPLKLVSSQNGVFSYEYYPSS
PGRYSVSITWGGQHIPKSPFDVAVGAKAGPQQIRAWGPGLEGGIVGKAATFVVESIGPDA
GVLGFAIEGPSQAKIECEDQNDGSCDVRYWPTEPGEYAIRVTCDEEDIELSPFMAHIVPD
TNVNHPEKVQAQGPGLEKNGCLINQPAEFTVSAENAGKGPLTITAQDADGLPVEVKVRSK
GDGLYRCAYTPTSPLKHTVSVTWGGVSIADSPFRVNVGRGSHPNMVKVFGPGVEDGLKAN
EPTHFTVDCSGAGDGDVSVGIKCDANMVGEREADVEFDIISNANDTFTVKFVPPAAGRLT
VKVLFNDKEVPMSPFVVKVNPSHDASKVKVEGPGVARSGVESGKPTHFTVLTKGAGKAPL
DVTFSSKVKDFDIIDNYDYSQTVKYTPVQQGEMNVVVTFGGDAIPKSPFTVGVAAPLDLS
RVTVDNLDARVEVNQKQEFLVDTKGAGGQGHLEVEVLSPSQRAVPCNVRPQAGRADASVV
RYTPTEEGVHAVKVSYDGHPVPGSPFPVEASLPPDPSKVKAFGPGLEGGLVGNPAEFTID
TTGAGTGGLGLTVEGPTEAKIECSDNGDGTCSVSYLPTEPGDYLVNILFENAHVPGSPFR
ADIQMPFDPSKVVASGSGLKRAKVGETSVVNVDCTRAGPGELSLEAALDSPSSGRKAKTE
VISNNDGTFTVTYVPTTAGMYTLLLKYGDQTVPGFPAKVPVDPAVDTSRVKVFGPGVDGQ
AVFREATTAFTVDARALTRRGGDHVKAEVRNASGKLTESVVTDNANGTYDVEYTPYENGV
HSVQILYDDAPVPKSPFRVSVSEGCDPSRVVASGPGLLEGLTDQPNHFNIVTRGAGIGGL
GITVEGPSESKMSCKDNKDGSCSVEYVPFTPGLYDVNITYGGEHIPGSPFKVQVKDIVDP
SKVKVSGPGVGSGVRANIPQSFTVDCRKAGVAPLAVAVTAPKGVAEPVEVTDNGDGTYTV
AYTPSVEGACSVSIKYAEEDVPRSPFRVRVLPTHDASKVRASGPGLTSGVPASFPVEFSI
DAREAGQGQLSVLITDPDGNPKQPRIHDNGGGTYLVSYIPDRTGRYTIVIKYGGDDIPAS
PFRVRATATGDASKCSVSGTEKVRERVGPTVAIGQEMSLAVNTKGAGKGKVCCVVVQPDG
SEVEAEVVENPDGTFDIFYTAPAPGNYVIFVRFGGENIPRSPFKVMATDEPPVSQKQARQ
QASAAGVGFQPWVPSLDSSSINGSGFKPFDMVIPFSFSKGEVTGEVLMPSGKSAQPQITH
NADGTFTVQYAPTEAGLHEMHIKYNDTHIPGESPLQFYVNHASSPSVTAYGPGLSYGTAN
KVATFTVYTEDASEGGLDLAIEGPSKADISCVDNKDGTCTVSYLPTLAGRYNILVKYNDE
HIAGSPFTARIAGQNNQRRSQVKVGSAADFCLDINETDLSLLTASIRSPSGRDEPCLLKR
MPNNHIGISFIPREVGEHQVSILKNGRPVPNSPITIMVVQSEIGDASRVKVHGDGLVRGT
TFEDASFVVDTQEAGYGGLALAIEGPSKVDIQTQDLENGTCGVTYCPTEPGNYIVSIRFA
EQHVPGSPFTVRVTGEGRIRESISRRQRAASLASVGSVCDLNLKIPAIDPQDVSATVTAP
SRASQPAELVAVGNDTYSVRFVPTEMGVHCVSVKYRGVHVPGSPFQFTVGPLGEGGAAKV
KAGGPGLEGAMVGEPAEFSIWTREAGAGGLSVAVEGPSKADISFDDRKDGTCGVAYVAQD
PGDYEVSVKFNEQHIPESPFLVPVVAPANDARRLTVAGLQESGLKVNHPASFAVHLNGAQ
GKMEAKVHSPSGALEECVVTELDRDMHAIRFIPRENGIHTIDVKFNGSHIPGSPFQVRVG
EPGQTGDSSLVTAYGAGLERGTTGVQSEFIINTKAGPGSLAVTIEGPSKVKMDCQEVPEG
YKVQYTPMAPGNYLISIKYGGPNHISGSPFKARVTGSRLISVTNMNEMSSLTLDPAVRAS
SSFAQSAAPRPGGSDASKVVSRGPGLSKASVGQGGSFTVDCSKAGKNMLLVGVYGPQAPC
EEVLVKHMGNLQYNVTYTLKERGNYILVVKWGEDHIPGSPFNVVVS
Download sequence
Identical sequences H2MSC4
8090.ENSORLP00000021661 ENSORLP00000021661 ENSORLP00000021661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]