SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000025871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000025871
Domain Number 1 Region: 18-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.11e-91
Family Calponin-homology domain, CH-domain 0.000000861
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-34
Family Spectrin repeat 0.0000642
Further Details:      
 
Domain Number 3 Region: 1007-1162
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-29
Family Spectrin repeat 0.0000268
Further Details:      
 
Domain Number 4 Region: 1644-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-27
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1858-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-26
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1220-1373
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-25
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 7 Region: 1485-1587
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-23
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 8 Region: 633-749
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-22
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 9 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-21
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 10 Region: 738-853
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-20
Family Spectrin repeat 0.00069
Further Details:      
 
Domain Number 11 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-19
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 12 Region: 1381-1479
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-17
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 13 Region: 850-951
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 14 Region: 2018-2080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000013
Family Spectrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000025871
Domain Number - Region: 1170-1234
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0921
Family Spectrin repeat 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000025871
Sequence length 2117
Comment (Oryzias latipes)
Sequence
TMTTVATELEPMDLQQQYSETVSNRWDDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLSRVSCRITDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKERRSAKDALL
LWCQMKTAGYPNVNIQNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTRLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIET
ENLIEKYESLASALLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRMELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGLDLQAVEAATKKHEAIETDIAAYEERVQA
VVAVSKELELECYHDIKRIAARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYI
MDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVSCNANKYSVTDGG
YKPCDPRVIQDRVAHLEFCYQELTQLAAERRARLEDSRRLWKFFWEMAEEEGWIREKEQI
LSSLEQGRDLTGAVRLLSQQRALEDEMSGRAGHLQHTITEGRAMVQVGHNGSDKILERIG
DLQAQWAELEQHAAVTRRRLEEALALHQFQADADDVDAWTLDALRIVSSGETGHNEFSTQ
ALVRKHKDAAAEVASYRPVIDSLHEQAATLPKEEAESVRGRLAGIEERYKEVAELTKLRK
EALQDALARHKMFSEANACQVWIEEKEQWLNATEIPEKLEDLEVVQHRFDSLEPEMNNQA
SRVAVVNQIGRQLMHAGSPSDDIKAQQDKLNNRWGLFRDLLDLKKESLNSALGVQNYHLD
CNETKSWIKEKTKVIESTQELGNDLMGVLALQRKLTGMERDLVAIEDKLGDLRGEAQRLA
EEHPDQAKAITGRLAEITAVWEEMKNTLKRREESLGEARKLQQFLRDLDDFQSWLSRTQT
AVASEDMPNTLAEAEKLMAQHDGIKNEILNYEEDYQKMRDMGDMVTRGQTDAQYMFLQQR
LQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHAEMPPTLEG
AEAAIKKQEDFMTTMDANEDKINGVMEAGRRLASDGNINAEKIKEKVASIDDRHKKNREA
AVELLMRLKDNRDLQKFLQECQELSLWISEKMLTAQDMTYDEARNLHSKWLKHQAFMAEL
QSNKEWLNKIEKDGTLLVSEKPETEVVVKEKLTALHSMWEELESTTQTKAQCLFDANKTE
LFTQSCTDLDKWLGGLEGQIQSEDYGKDLTSVNILLKKQQMLENQVEVRQREVVELQSQV
KALGQEAKDTDEVDGRRQGVEKKFQELLEPLRHRRNLLVASREGHQFNRDVEDEILWAQE
RMPVATSTDHGHNLQTVQLLMKKNQTLEKELQGHQPRIDDILERSQSLLRDQTSGTEGIH
RRLAELQELWDRLREEGRRRHARLQEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDE
QSAITMLKKHQIMEQAVEDYAEVVHQLSKTSRGLVANEHPERCISERIGMRQSQVDKLYA
GLKDLSEERRGKLEERLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDGVNHLADELINAGHGDAATVAEWKDGLNEAWADLLELIDTRTQIL
AASFELHKFYHDGKEILARIADKQKKLPEEMGRDQNTVETLQRMHTSFERDVQALGAQVR
QLQEDAVRLQSSYAGDKADDIQRKDGEVLEAWRILLEACDSRRSRLLDTGERFRFFSMVR
DLLLWMDDVIRLIEAQENPSRDVSSVELLMNNHQGIKAEIDARNDSFSTCVELGKALLAR
KHYAAAEIKEKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYL
SSREVGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTLELLEVRRQQEEMERRRRP
PSPEQLHQEEVQQEKRW
Download sequence
Identical sequences H2N320
8090.ENSORLP00000025871 ENSORLP00000025871 ENSORLP00000025871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]