SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI17650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI17650
Domain Number 1 Region: 117-615
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.76e-140
Family Calponin-homology domain, CH-domain 0.00000000304
Further Details:      
 
Domain Number 2 Region: 7-84
Classification Level Classification E-value
Superfamily EF-hand 8.85e-21
Family Calmodulin-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI17650
Sequence length 623
Comment (Monosiga brevicollis)
Sequence
MASDNVEWQSIQFKEDELKEIKETFANFDKDGNGHVTADELKELFREIGEAVPGYQLRQM
IEEVDADKSGTIEFDEFLNMIRKARVSGGRGTGKVRANIKKMGGTSAASAAATTHSYSDE
ETVAFADWINYTLAEDPDLSSVLPIPNDHPDKLFKAVHNGLVVAKLINSAVSDTIDERAL
NKSNLNTFNIGENQTLNVNSAAAIGVNITNIGAQDLIDGTPHIVLGLLWQIIRIGLLSKI
NVRDVPGLTALLLDGEELSDFLALSPEEKLLRWVNYHLERAGTAKRISNFGGDIKDSEAY
TFLLAQIAPAEYGVDTSALDILDDTQRAEAVLNNADKLGCRKFVTARDIVKGNPKLNLAF
VANLFNNFPALHVEGNAGEYELNDVDGETREERTFRNWMNSLGVNPFVYSLYSDLNHGII
LLQLIDKVKPGSVDWEKRVNKPPFKKFQAHMKSIENCNYAVELGKQLGLSLVGIGGSDIY
AGNKLLILGFVWQLMRGYTIKILQTLSGSDALISDAEIVAFINERLTGAGKPTISSFKDD
YISTSLPIFHILETIRPGVVRADMVHDPPSSEEEKIANAKLAVSLARKVGAGVYALPEDI
VEVKPKMILTIFACLQARIMRGK
Download sequence
Identical sequences A9USM9
81824.JGI17650 jgi|Monbr1|17650|estExt_gwp_gw1.C_30354 XP_001743094.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]