SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI22129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI22129
Domain Number 1 Region: 105-303
Classification Level Classification E-value
Superfamily EF-hand 2.56e-22
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 2 Region: 293-377
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000165
Family ZZ domain 0.014
Further Details:      
 
Domain Number 3 Region: 51-90
Classification Level Classification E-value
Superfamily WW domain 0.00000000000727
Family WW domain 0.0015
Further Details:      
 
Weak hits

Sequence:  81824.JGI22129
Domain Number - Region: 896-979
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000195
Family Calponin-homology domain, CH-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI22129
Sequence length 1011
Comment (Monosiga brevicollis)
Sequence
MGRAKAVNKASFGQQGSSISVSSQRSDDDRLASRRAMTTVWRSEIVPARKSMIGEPLPHG
WAKALTDSGTPYYINHETRVTQWVDPRLQSCLQELSAHDDIRLAAYRTAIKLRDVQVYLR
MSQIKLPTALNAFYALDVHSDYSSGQQIDAEEMAVVLMEMYADLPHPQRNVEVMISMMLK
IYDRNRSGHISLQAFQTALTLLSVSWIEEKYRFLFTIYDTNQDDFITVEQLTQLLRHVVG
LPNGIREAYAFCPTKEFPEQEAHRVFELERERNGAAATQISLNTFVNYCMTDPRPLLWLP
VMHRVAATENSKHETTCCVCKMYPIIGFRYKNMTSMDRDVCQECYWTGREGNGHKASHEV
KEYCFSSTARQDAKDFFGRIKRKMTKKKADESEAARTARAAKPVPVAEPRMSVAVPYEQA
LQEPAEGDDVVDHADVGLSHGVAGLQDEHDLIQEMAAQLKAADDEGGPVSTMVVNLETEQ
KLHLLRVIDELDAENRQLLQRLMDSERDRVAELQEPVAGDEGVRDAMQGRINDLNERNRD
LVDQLTRLQAMLVASGMAQGHDNDNEQVNAPAYELARAGTHDDMPIYERAAHRANEYPPH
TQLQHGALQATNDDEPDISLFLFVWKAYDPSHELAAIADSLSTAFADLRAEVCPDSALRY
LMAIAFTPCLAAPKPTEPGHCLDEIKASSDAPTRAPRRSLLNSEERRELWGAETAAMLEE
QDQYGNTPLPRDTIKRQKNSIRSASFRLRARLGRLASYSPDPASMAQDFVLAASPMPTPG
RRGSDTRASDASPPLRARENSRRSSAEGPPPPPALTTSTPRVYRAPSMADASPDASGEGR
IARHAATVRRPDLGERRLSDERLGAVSNNFESRVLASRARVQQILGVQSPDVTEANAVRD
YLTVFSDGYLFCLLANHRLRERKLTQVKPYRSPLKAYPSAAERLTPSQVVENFNMFHSAW
RTLGFDETRVPTWGDITHVAEEVDLSPQQRRYSLKVLEAVETLLALSESKA
Download sequence
Identical sequences A9UPN1
81824.JGI22129 jgi|Monbr1|22129|fgenesh2_pg.scaffold_2000336 XP_001742662.1.20067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]