SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI31066 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI31066
Domain Number 1 Region: 225-418
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-46
Family DBL homology domain (DH-domain) 0.0000982
Further Details:      
 
Domain Number 2 Region: 610-707
Classification Level Classification E-value
Superfamily SH2 domain 6.19e-20
Family SH2 domain 0.00074
Further Details:      
 
Domain Number 3 Region: 3-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-19
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 
Domain Number 4 Region: 585-606,727-774
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000591
Family SH3-domain 0.002
Further Details:      
 
Domain Number 5 Region: 413-540
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000369
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI31066
Sequence length 931
Comment (Monosiga brevicollis)
Sequence
MPELWQHTADWLCKLGALSGEDPTFQKDATVYDLTVALQDGTVLCDAANALVPGCIPIVN
RHPQQQFLRIQNIHAFLGALRNTFKMKEAHLFTADGLHNGGEMPQVVQCLATWANTPQAV
KHGVKLGEATNTPNTALDADGRYDMYKSLKQLVEQNLSLRDAGTYTMSHSRPNSMVSDHQ
YYSEKVGTMKQVDELYYMIIYAGNTPALKLDEATDENIYGAGVTRDQKRSMVLDELFSTE
NSYIKVLQMLTGTYLPNLREAFSIIDIHLIFMNITEIMDAHNRFLADLSELMARTTGRMA
GTCLLNHVTSFRIYGEYISMLPDAIDRLKVMRKKAPFQAALQAAQKASGQIFPLEDLLRV
PMQRILKYPLMIKELLKSTPSDHPDLDKLRVANTAFQDLATYINESKRDRDNLLNIIQNV
KKYKGKPIKDFGKLSRDGDLWVIDHVIGDKGKLRYVFLFDFGIIVCKHNKGSFKFKASVE
FQHRQSVESVSDPAGEDGYPHRWRLMDTSGKKPVPLLTFGSYHEATKMRWMDMIRGKMLA
VATPASPPPLRARMSLRAPNGASSSPKPRRSLSESAAVGSGLARPPSSPRPVLSPPIVGP
RVPRNSVADDEAWFLPGAASLSESELKDLPDGTFLVRESTSRQGSYSLTVVFQNEVKHIK
ILRDGTQYRLTEHAEGFDTVQQLVAFFQRQNLGTYFPTLDTPLVMPYRSVMMQRALDTDS
SDMLSGIGRARALFSYKATADDEISFDKGTELVLLNVVEEDDGWWRGRLPDGQRYHQLTA
PPVLSILTGLRMCRLGWLGHVFHSPIIIHSKRSQTKVSDIRSPFNMMASQVKRLLSPAQL
AAARSSVFGHIARPANVRSPVKYLQAKPKAEAVMNYYPDLLVKHESLWRRWYNMGIYYDE
AMVWRTDKMAWNKSRGRFPVKKGEGKKKKKK
Download sequence
Identical sequences A9UNJ0
XP_001742464.1.20067 81824.JGI31066 jgi|Monbr1|31066|estExt_fgenesh2_pg.C_20809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]