SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI32092 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI32092
Domain Number 1 Region: 156-199,232-306
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.4e-21
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1330-1417
Classification Level Classification E-value
Superfamily GAS2 domain-like 4.05e-16
Family GAS2 domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1256-1325
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000084
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 
Weak hits

Sequence:  81824.JGI32092
Domain Number - Region: 1075-1117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00104
Family Calponin-homology domain, CH-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI32092
Sequence length 2346
Comment (Monosiga brevicollis)
Sequence
MSRSTSFYEPRRASTSNDATQRRRSDPVLHQDTSLSTSRTGASSNDVTLTRTIRSDNKDP
YDELRPSYYDIRRRSQDELYKPRRSSRGGDQDLANERRSTVVPNDQRRKSSRGSMFSYIG
GPEQRGSVRVIYDDSDHPHLEDYFSGQRNRVTYDRLRAYRVDLALWLNSIFNTQLTEANL
LQELETGVLLCRLAMKLQADSGSLTRGFASGHSRRVSNDPVKIRCNMSATSGSFFARDNV
ACFITWCQSIGVDDAVIFEPEDLVQHKNDKNVLYCLMEIARIQTAVEPPTLIALERTEGK
PQDEDELARLLRAVEEECKASGHSPSRVRHVGNGRFTVDGYGPTTMGLLHDAVVVRVGRE
WDSLPHVLDNPSLVVKTVSAPGGSSPDLRTDRRERSVQSTELGTINEDATIRNLRRRIAE
LEKMLADRTAELDAARASATRNNLDYGEASNSVERLEKELNRVRGVLEDTSTENNELREE
LDRLKMMLARLEREQQVKQGGITRAEHERLLMEQRQDLEEEQRRALKDARSQHGAEIKQM
SNRLKTLEMSEATLARDKDDAQHDLEAANDELRTCQARLQAAEALLQTREAELEDERQAV
ADLREHAKDAEELELLRRRLRNAEQRLGDQDKEISRLEPFEERSQELEAEHKKMQATMDG
LIRDKSKLRSELDELRAKLAALESENAKNASETQKANELEAQLAELTKQLQSAEADCEAS
AAAEREANEKLARLQAEQEASADREKSANSDLAKQLAELQALLATRDNELAEERKQRDGL
EQELAALKKDMDSKLAEDSEESARLRKERDEERAKAEELQSELDQLRQQNEDNKQKCKEE
KDALRQERDKALQERDDLAERLSALETECAQLKEQLADKDAEIERLKARISELEDILSQR
EGELTAATALNEELQFRLDELTGNLADKEREAEDLARQRAEAEAARQQAEEEARKRAEEA
AAQQEQAKLAADRARELAEKEAARLAAEEEAARLAAEAAAARLAAEEEERKRREAAEEEE
RLRREAEEEAERKRLEAEEEEARLQAEAEERSHQAALEALRTDEVKMNMHRQMTHYREDI
CDWVNEMLGTNLQQNTFLLKMQNGVLLAELANAIDGDEAQLRAEEAAQAAETAATSKDTG
AKGNTARGSSIKPPTSRASSGSLRAPPAARRPSGPPKSKSRSTITAPNGAAAVPRPEAPA
LQGIRTRLPSAHDPVRINRRRLELFKFDTPANEEGLAEFIRTRPLQYCRYEPIARSGTDK
AHSNINNFIEWARSLGLENPDVFELEDLTELRDERRFIWSLYDVARRTRGIRVPRLVWIE
RIRFLKRQRPIKGDKLDAAVYKVVNACINQPPYKASCAVRQVHRVAEGKYVFGDEASKPV
LLRITEKNVMVRVGGGWETLKRFLETRFETDPKLKTDKARTEELWAEHLAAAEKGEPIEY
QASDLSSINLFTTRPDYRSFQPDFTPGNEAEDTSAGEPTAILSFLSLSLSLSLCVSVLLG
ICCQAPARQHAALQRVLGREAKLAGKRTLKSADSIRESALLLPALPPNAFPTVGGMHAPG
ATANRDMPTVVTPAHYPGLATWTVATGVARPHSGISKLKIPTGPFGNDYIDLHLVEPFGA
QLEELPLDTLVFREPGQSLVFYLPLYFEQQLQPNLAQRIDTRFRVCKDSRDLVKKFLVAL
SQWSDIAPEGPAAMFLSQCLSHPILSRLREPDEASRIISPIIGCGTNRRVKSSLADSPQF
AVKMNRINLALNKVGLHAEYRPGNEKDKGLRVRRVPPVAPGTSMSPSAPLGHVPAHVTAP
NLANSPMQQSMSPNASAPGSARHRGTSKPVSLRAVDPRVALVTPSTGGLHAAADVSGMDR
SRAPAHGEPAPLPLNEDHAQPADGESGPDVDRDPNDEHGSSLEPQAPTQVMLQQGDSLDE
NAANSSVPSQAPLQSQPAHGAVGPAAHVDAPGGTGSDAPAPSTSLSHAVPPLAQPNATAM
GIPLPSSSTVMATSYMNPPAYGATMQEHPTLYTNTPLPPRSRNLPRQSSSSRRRSSQPQP
QALASLDTSGAPVMASQYLNTNAPMPYPPAPYVMGPGNASLPPMQMALSHEMMSPMAMVL
GRRRPTSAEEAILSNPIKLLEKLLQLVDPHKDKIPVICNLVAYSMQDLQQGASFESRLRC
LQLLLRQTDVLMTMPIWQMLGDEEYVSAVLSTLDSLRSALITTDNELSVVASQIVHAEVP
EHVAADDNTDDNGEPSAKRPRPQDLEKELMHAQPPPITLQGLSRLLTDVLPRRLPAPAEV
PNSLLEQLQSTITTAADPTAMVASLCFAMGSMFAHMHEDSGAGSDTDAMVNMAPIHHPPA
DIVPES
Download sequence
Identical sequences A9UXD5
XP_001745137.1.20067 81824.JGI32092 jgi|Monbr1|32092|estExt_fgenesh2_pg.C_70299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]