SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI32785 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI32785
Domain Number 1 Region: 11-244
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.57e-80
Family Calponin-homology domain, CH-domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 263-383
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-25
Family Spectrin repeat 0.0000386
Further Details:      
 
Domain Number 3 Region: 346-494
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-21
Family Spectrin repeat 0.0000827
Further Details:      
 
Domain Number 4 Region: 727-877
Classification Level Classification E-value
Superfamily EF-hand 4.88e-21
Family Calmodulin-like 0.0027
Further Details:      
 
Domain Number 5 Region: 501-609
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-18
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 6 Region: 617-728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000838
Family Spectrin repeat 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI32785
Sequence length 882
Comment (Monosiga brevicollis)
Sequence
MAATSQSAAFAEQEEGPRVLDDQWQRQQQKTFTAWINSHLRKRSLKIEDIAVDLCDGKLL
LQLVEIIADETLPKAAKGKMRIHNVENVGKALNFIQSKGVNVSSIAPEEVVDSNLKMILG
LVWMLILRFEIQDISEEHMNAKDALLLWCQRKTEPYNNIDIQNFHMSWKDGLGFCGLIHR
HRPDLLDFSKLRKDNPRENFELAFEVAERDLDIPKMLDVEDMLTCIKPDERSVMTYVAAY
YKAFASSNKSELAAKKIAAVLETNREHERMMEEYEEMATDLLAWLNTNIERLDQRPALNT
VPECQSQLEEANKFRGEEVPPKLEEKSRLEMHYATLQTKLRLSGRPPYVPNEGKEIEDIH
NRWQDLETADGNHKDFLLEELRRVRLAESKAERFNAKATTHENWTQGRDEELASDDYSDK
NLAGISALLKKHEAFQSDLTAHEQRVHEIGTLANELDELRYHDADSVNDRYAAIYETWQT
LVQLTHDRQTNLQQAEERQRHLDDLFLEYAKQAPPFGNFAELACEKLQEPYIVDTEEDVT
VLQQEHEAFKAELPQYQQAFESLQVLQQGMQELGNTSNPYSPHNFEDLSQQWTRVQELVT
RRDEQLAEEASHQQGREQIRREFASAADEASAFLQNKDSTVNQIIEQSTQATLEDAVQQL
QGLQTEVEQHRSSQDALEGIHQKQQEKLIYKNPHTSATIESVRGHFNALKNRIVAQVNEF
NNQILSRDATNITDEQMAEFRQSFEHFDKDKSGRLERREFHGVLLSLGHPVAEVYKDDGS
DKEFESIWERVDLNKEGTVTFDEFVRFKAEESAGAETSSQLLEAFQILANGQPYVMATDL
QRELSPELYEYCVQHMVPYGDGPEGALDYQSFATALYGESEL
Download sequence
Identical sequences A9V1P2
jgi|Monbr1|32785|estExt_fgenesh2_pg.C_130120 XP_001746581.1.20067 81824.JGI32785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]