SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI3432 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI3432
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-27
Family Calponin-homology domain, CH-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI3432
Sequence length 73
Comment (Monosiga brevicollis)
Sequence
DFQEALKDGTTLCALANAIQPGAIAKVNKSSLAFKQMENINQFVDFARSKGVRSDDLFQT
VDLYEGSNMVQVC
Download sequence
Identical sequences A9UWQ2
XP_001745021.1.20067 jgi|Monbr1|3432|gw1.7.316.1 81824.JGI3432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]