SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI38472 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI38472
Domain Number 1 Region: 600-666
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000141
Family Calponin-homology domain, CH-domain 0.0075
Further Details:      
 
Domain Number 2 Region: 21-88
Classification Level Classification E-value
Superfamily L domain-like 0.0000374
Family mRNA export factor tap 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI38472
Sequence length 1535
Comment (Monosiga brevicollis)
Sequence
MSTTARVKEKLAAAGETGVFDLSDAKLHAFPNLSNLDLDELIHYEVLEINLSNNKLVRLP
DLSDFEELEALDCSRNALTDIEKVARITSILTRINFSPPPASSTGDAQEAEQALEMLENG
AKAAEFRAAELRAVQEQERAEQLRQQVEAERRELEARRLAQSELAQAQQADIAEQMRRFE
EQRKELQAERARQQKEAAAQAEAIEQQRRQLEREQERLRQVEAETARRRTEAEKAQQAAS
TARQQAEAEAERQRQVAHREAQEQAARAQAAQEAQAQRERAERERAERERAERERAERER
AERERAERERAERERAEQLAQQKAAREQAVQEQQQQQQQTDRARRALAEQSTGASRDKSR
QRGTPSNIRVENTTSRTLPVPRTGTGGTARTAAGGTTADARSNQARYTPSITAYPSLVQG
ATGSKELPVPRRKNSSQPSVAAASAIGNATAPTSTRPVQEMAASPARSGVQPLSRNIAAT
PKSAPTTTPQRKEPFTPSGPSYTTVSSRELDMLRARRRARLVKLHEQDMKEMRNSPEALN
TVAFDLMEVMHEEDNTIQVGGQGIKSFLLRNRVERAGKNTLRRLARLALQEALLYHFAVE
LINLKRPDSVPKVYMNENDALSGANLKLRKNVDGFLEACRRLQLNTVSDVSSLDILQEKN
TDRVISLGAKMATHPVRNLRAELDGGGLHAHASTDTRGGMPRARVSLTLGRHMFVDDDLE
RLQAEFQQQQVQPAAAVLRAPPQVGGALTARQHAPPQASAQTAPRQLHKNKQHVKETQPE
ATSSLQDHHSEAPIHAMPLGGSILTDVMERQSLRQPSGPRPADSSSPQAALQLKPGFGKD
GTTPKGRKSLFARAFDGSHPQWQPRTHAPAPRTGVRFESQPTSKSDRPDLPVASMASKDP
AQMSAAEREEAMQEVQRLLTPENIAFLKQRAQQRASKSDSAKPAVSSLHTQARPVRPPLK
DSSTKKMHQVPPSPDPSSMSAHQLERVFAGEETVPPTTALEADKMAWLQGDLPAADAAVS
DASITMRQRQAVRVLRRLCAASRRHAEHVVQLDVLHLIKGYAAIRPNKTAESSDSDYMFA
TESLLLVADFARTLLHHPELQAWVKMPTVTTFIQQFVGDFAEHGPSAVFQLQPVDELLAL
WTRLQVTTTSMAQSDDLLDVILRLVTVVSSTSAPMVRNVLNETQQHITTPGARKVLQFLH
DKLLVADDNMNTRLIDYQLTATSESSLVLPLAPEWFFAALRSVQTALDAVQDSLSSSAAE
EVALDTSAILEFYAHIFDVQSALVKGIGIDLWYSELLRAYTLCDPIPSFGSVQKPMSRLL
NFVALHCREVGATVATATELDLQYVQLASSAHDRVLEDILFSGSSDTIHQQFLLLPLAHP
WPSDFRKSLLCHDSIAQVLQTTGSDLMPILHNFQMPLEKDRSIVDLMLRQLFNVQPAQSL
LYWLCLHHVAAFLFRDFGFGMDDLTASLNDDPHAQDHRHHALKRVESLEPAVRRDLLCYA
PSTPIKSLDEVWSNEESVVPATRRELLVQALEMAS
Download sequence
Identical sequences A9V809
81824.JGI38472 XP_001748788.1.20067 jgi|Monbr1|38472|estExt_fgenesh1_pg.C_250117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]