SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 81824.JGI38563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  81824.JGI38563
Domain Number 1 Region: 230-338
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-29
Family Calponin-homology domain, CH-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000177
Family Protein kinases, catalytic subunit 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 81824.JGI38563
Sequence length 342
Comment (Monosiga brevicollis)
Sequence
MAADAAEGMAYLASKKIVHRDLAARNALEVVEKVCDEDLRMWKPEGCPDAIYDLMMQCWE
EEPDERPSFKALHESLTAYHKKANRATIVTVDDDEGAAAAADEYSLPQDSIIRIAAPQPD
DIIEDWNPYGLADVDIANYGLVGMNAPQPPRPRPTAEPAEYSMASAPSAAQDDDEGPSYE
MTGGNRAAPVLYETTESKQARTEAPLYDTAEAERRPSVTPYSKHGMRKDEAAQVMIAWVE
NVTGKTKPEGADMHAWLKDGQILCELMNKLQPGSISKVATGNRAFHHLENISKFVSAVGD
LGVRAADRFDGVDLFEGINMHQVTNCLASLHKVAVSKNLIKA
Download sequence
Identical sequences A9V8S1
XP_001749116.1.20067 81824.JGI38563 jgi|Monbr1|38563|estExt_fgenesh1_pg.C_280003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]