SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000000093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000000093
Domain Number 1 Region: 3-77
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.91e-21
Family SNARE fusion complex 0.0000648
Further Details:      
 
Domain Number 2 Region: 131-204
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.31e-19
Family SNARE fusion complex 0.0000747
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000000093
Sequence length 205
Comment (Xenopus tropicalis)
Sequence
MDDMTPEEIQLKANQVTDDSLESTRRMLNLALESQDTGIKTITMLDEQGEQLNRIEEGMD
QINKDMREAEKNLTELNKCCGLCVCPGKRPKDFESGENYKKTWGSKDNDSENVISKQPHQ
TNGQQGGVAQSGPYIKRITGDDREDEMDENLTQVGSILGNLKNMAIDMGNELESHNQQID
RINEKAETNKTRIDEANTRAKKLIE
Download sequence
Identical sequences A9UL74
8364.ENSXETP00000000093 gi|163916283|gb|AAI57149| gi|166157868|ref|NP_001107340| NP_001107340.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]