SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000002486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000002486
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 3.61e-47
Family Globins 0.00000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000002486
Sequence length 142
Comment (Xenopus tropicalis)
Sequence
MLFSDAEKAAVVSLWAKASGNVNALGAEALERLFLSYPQTKTYFSHFDLGSGSHDLQVHG
GKVLGAIGEATKHLDNLDEALSKLSDLHAYNLRVDPGNFRLLSHTIQVTLAAHFQADFDA
TAQAAWDKFLAAISTVLTSKYR
Download sequence
Identical sequences Q6DES4
ENSXETP00000002486 ENSXETP00000002486 NP_001005092.1.99540 8364.ENSXETP00000002486 gi|49900021|gb|AAH77020| gi|52346090|ref|NP_001005092| gi|77819911|gb|ABB04098|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]