SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000005555 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000005555
Domain Number 1 Region: 204-283
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.44e-29
Family GAS2 domain 0.00000513
Further Details:      
 
Domain Number 2 Region: 28-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.78e-29
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000005555
Sequence length 316
Comment (Xenopus tropicalis)
Sequence
MMCTTLSPAGRGPGLSDMHQYSQWLAIRHEANLLPMKEDLALWLTSFLGKEITAETFMEK
LDNGALLCQLAETLQDKFRENHTDANRKLDKSLPTKKIPYRANAPSGSFFARDNTANFLA
WCRNIGVGETCLFESEGLVLHKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEIEQEEI
LSTPTPSPSPSPTKSPGKKSTGKLLDDAVQHISEDPPCKCPNKFCVERLSQGRYKVGEKI
LFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPVQNKSPTIKDMSPD
TYLVVSAHYKSKKEIK
Download sequence
Identical sequences 8364.ENSXETP00000005555 XP_017945383.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]