SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000005586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000005586
Domain Number 1 Region: 1346-1485
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.82e-58
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000618
Further Details:      
 
Weak hits

Sequence:  8364.ENSXETP00000005586
Domain Number - Region: 204-270
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00756
Family Calponin-homology domain, CH-domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000005586
Sequence length 1490
Comment (Xenopus tropicalis)
Sequence
LDVYDVQQARISASLSWLIYRYYGKEVPAELCSPCYTDQYEQEHVKPAAIALLLSADIYC
RAYRRALPHDSSPPRDNAGLLLMLARKGLAPTNQGEPVKTSDLREKPIRMAAHLALIDSL
MTLYSIHCTAPLPPDAEISLTSVETKLLDWIDKVNNHLLDEAEREQGKKQMSAPEGQNQA
GIRYRKDKALSRQTPCFTAVSSLRDLSNGSALAATVHYYCPAQLRLQDICLKDTMSVADS
LYNLQLLREFYAQHLPPSCPLSLEDLLYVPSALKFISPSLFFLLRGLFTFRLMAHGETSH
DFEKPKPSIGPATGEQLAPCISHSTFFCYSPSSLSPRVPSSTHSSHCHFKLYLLLFLGQT
TQPSPVHSPIPSSIAISSLISCFTCPPIPLFHHLSILAFLHPSTPFIHSVLHKPLPSPPD
LIDTSLHHSISPVNIFISMQVNLVALLADLYLCFEVAKPDFVQPKDVYLHSESATPSSAH
SGGYVSKIFLYFIPSTILTILCLISLLIISFFSLQQVPSLQLQPAWQHGSSFLLLIPRLP
SSFLFNVPHGRIWKGVGKKPSEVSLPRLQCNNIPFGLDSDVDIVMGNPVNIMRSVSSDSL
NPPAFPPKSPSCVSRATYTPPEDAAELRTLKKVPGKVTSDLNSQDKTAGSPGVQSDLPTI
EEALQIIHSSESPEEAKPPKVEELVVTPNVGVYRTHNASRRLSRDDDSVLRDNSLDSDAE
ETKPAQDSSRSSLSSQADSSTGPGTKMTSFAEKKKKINAKATPEGSPSSLPLNSPNTTTW
AQKAEESPVKSPALNSEMNQLSARLEEKRKAIEAQKKRIEAIFAKHRQRLGKSAFLQLNK
KDGEEGEVEEGKLSPDEGLPKELDDEGRRKQFSEDENNDEKSDVVMRPRVEKQVSFSPDV
AKEGLDNNLGDYNRAVAKLNNALSSLQSDMKRLSDQQDKMMKKESKAWVIPAPKASPPPH
RPKSSPPVRLTREIQAPRSSLPASPSHSPSRFVPKSPQPNARRSYQPVPITPKSPKTNRP
VELKLPPVNRVLTLPHNVDTIPHLRKFSPSKVPDQTKTSIYVTHKGLEGEEDGETVPAVE
GHGNMRPVASVVPQSSGVAPWTEETESKRSSLIEIPLSDLRAAEDSETEGPDSLEGTPGE
DELQRGGVGFFFKGEERTEDEMAQRRAALLEKQQKRTEEAKKRKQWQEEEKEKKEESRQQ
QQQEEQKRKEEEVVARRGDFTRKEYERRLQLKIMEDLDKVLRQKPMTVRAVKKPRPKTVF
RDDSVISRSPVRGLLGSKLSKVYSQSTMSLSTVGNETFASHPHDTNIYLVCLVPAEPCHL
VAQCLQLKNGDKDWDAASTASSPASIPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKV
NESQKIKVLEDMEKSPANHFLILFRDNSCQFRAVYAFSAETEELSRLAGIGPRTISLAMI
EDIYKYSSDRKRFTQIPSKTMSMSVDAFTIQGHHWQSKRPTTPKKAGTPK
Download sequence
Identical sequences 8364.ENSXETP00000005586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]