SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000010221 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000010221
Domain Number 1 Region: 905-988
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000129
Family PDZ domain 0.024
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000578
Family Calponin-homology domain, CH-domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000010221
Sequence length 1507
Comment (Xenopus tropicalis)
Sequence
SVPFCLLTKDNINVFLRACETLGLKEAQLFHPGDLQDLSSRVTVRPEETDRRLKNVLITL
YWLGRKAQSDSYYNGPYLNLKAFEGLLGQTLIKALEESTSSKRSGRDSGCSDLWYSEQRD
SLTSPPIHKRDDSWDSLDSFGSKSYTSFSSDTTIKGSSEGGESETESELTDKMQDSSKDD
MSYRRLSAMEPKATTTFNKFLPNKVKQFNYMPAPLRKKRIDKNEDNRRSWASPVFTEPDG
TFSSQDQKTDGQKQTKTVLKDSFEYSSLTSDEDDDFTRDVPNIVNDDLYVRKVGVPAPQS
KTSFDMFLPNFSAQEDDQLRKQIRKGMCSRPWYNEFQGFSQFLLLQALQKMSYDALTSKT
KSDPTSGPRVVTSCHKPSNQNEDTMEMLPNLQNDDFFTRKTRTFHLNQVINLGTPLVRVC
EIEKDIICQSKLEDSELPDLVKDDMTIRRVQNEPKEIHLSGAPDNYHPVPFPEPWTLPEN
IQSKFLCTVTKKQESAKEDKCGGVIKMSDKLKKDDMLTRKVNLCQTSNSLTPKSFIPGPC
NDKDFKKWEWIREASKARHKKRLLVERLKEKLSINSGSKSLEAITADELISNRQVRFEEL
QKIRTQLQDQDQKWQDDLAKWKSRRKSFTSDMQKKKEEREELEKISYESPERTYKTFREM
QQERETRNQDNYYMSKESSEDRKMYSSNDDVFGDAPSKRMLERSYTVAVEAPYSMGKGTS
SVQNKENDRGVISELLPTSNSTFETDGTYSSKANTSSFVTESKPIPGLASLPRSYQKNDT
SRITSVVTPRPFGIQSKGITSLPRSFTVDDSFKYNGDLGSTKNNSAFNSYIKVEEKPNRI
KRSEENDEPDEKESIRRSHSPKPFPGVSAAPEKRIISESVNVTSSARGVDQTKVPGPLDQ
YSDLRISINQKPGSSLDFGFKTSWNSSGVFVKSVDIGSPAEFCQLHVDDEILSVNGTKVS
SMDYNQWVEAMDHAVETGNLAMDVRRYGKNGSPENKWIDASRSQSTSLKKDVPDSGNVST
LKFYLQKLCSLFFSQLESESISLKNYKRRSQFFEQGSSDSSLLDMPVPSINVSTRRSWDP
EDERKRQEKWLQEQEQILQEKYKREQEQLREEWERAQQEAEKERFHQIQQVSLPITSQSS
YWKTFGSDLHSSEEENRQKESSEEELESERQWKRAEEERLKYLEAQRHHEVEEQRRQLEE
ETNRRQTEEENRRRQAEEENRRRQAEENERKRQEEERKRKEEEMRLQRAAEEERHQKKLQ
LTKSQKYSHGFLPIYRQVLPGTLGLGDHTDSGTSEDTGNVQQRPYREQLQGSAEVERQRI
IQEMRKKAPLNNDNSWIRQRSSSMTKEASTLPNYMRRGESLDNLDSTSGLQRVSPWANQS
SSYNSLSSSQDFSRPSQVVSTSNRTFLRNSSNSLPQSAAGPSKSASLPQSSAVSQTSNQQ
RNNALHVRPTLEVQNLELKSESVTVSCTATAATSNSKWDSQPLCEGTVSPEPLEDVSEEV
CASHIVA
Download sequence
Identical sequences 8364.ENSXETP00000010221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]