SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000015106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000015106
Domain Number 1 Region: 61-152
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1e-27
Family Platelet-derived growth factor-like 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000015106
Sequence length 214
Comment (Xenopus tropicalis)
Sequence
MFKKISEGAVTSISELRRVLQIDSVDDEDDLNYASIHQTRSSPTNSSSHSRVIRSLDAEK
AVIAECKPRVEVFEISRKIVDPTNANFLVWPPCVEVQRCSGCCNSKNMRCAPTRIHVRHV
QVNKIFITPKGKKQVKVVVPLEDHHDCKCEPVPSSAVRIHHPPPETKKAEPPPSTMAPVP
ASQKEEQPLRPHKKKNRKFKHLPSKKEQRELLVT
Download sequence
Identical sequences 8364.ENSXETP00000015106 XP_004913816.1.99540 XP_012817969.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]