SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000018009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000018009
Domain Number 1 Region: 240-423
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.02e-46
Family DBL homology domain (DH-domain) 0.0000000243
Further Details:      
 
Domain Number 2 Region: 2-120
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-26
Family Calponin-homology domain, CH-domain 0.0006
Further Details:      
 
Domain Number 3 Region: 165-236
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-24
Family SH3-domain 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000018009
Sequence length 425
Comment (Xenopus tropicalis)
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQTSLKDGVVLCRLLERLLPGSIDKVYPEP
RTDTECLGNIREFLRGCSAFNLETFDANDLYQGQNFNKVLNSLVLLNKVTADIGLGSDSV
CARSSSHRIKSFDSLGSQSVLSRSSKLLQSQYRSLDMTENSNHHMVVRAKFNFQQTNEDE
LSFNKGDLIHVTRLEEGGWWEGTHSGKTGWFPSNYVREVKSSEKPVSPKSTTLKSPPKGF
DTSAINKSYYNVVLQNILDTEGEYSKELQDILSNYLRHLQTSEKLSPTNISYLLGNLEEI
CAFQQILVQSLEECTKLPEGQQRVGGCFMSLMPQMKSLYIAYCANHPSAVNVLTQHSEEL
GEFMEMKGANSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRPDIQKSMTAFK
NLSVR
Download sequence
Identical sequences 8364.ENSXETP00000018009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]