SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000023557 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000023557
Domain Number 1 Region: 44-115
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000132
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 
Weak hits

Sequence:  8364.ENSXETP00000023557
Domain Number - Region: 104-214
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.0051
Family TF C-terminus 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000023557
Sequence length 287
Comment (Xenopus tropicalis)
Sequence
RGGTEQAEYCLPSPACVCHTLPALPCLWSMACYPEVPRRTGVPREVLKWLQSLDLSFSPK
NFRRDFANGYLIAEIFYWYFPEDIQLHSYENGTSLANRLSNWSQLEKIIDKYKFNQGRQI
LLSTLAHKVHPQNTVSGLFTELQRTKIKMIQDNEVDFTDCHYQNKLPMVARSTATKTVKS
NVTLTEILAEPDIIINKQKVQALMGLHLQQRQQERIEDPKRFNVKPSLGELAIRVPPTVN
KKLYESNGNLHKSATDFSVIVYGNGQCRKEIHMDGHGIYPFLITENR
Download sequence
Identical sequences 8364.ENSXETP00000023557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]