SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000025577 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000025577
Domain Number 1 Region: 91-135
Classification Level Classification E-value
Superfamily LysM domain 0.000000034
Family LysM domain 0.0047
Further Details:      
 
Weak hits

Sequence:  8364.ENSXETP00000025577
Domain Number - Region: 473-515
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0539
Family Calponin-homology domain, CH-domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000025577
Sequence length 891
Comment (Xenopus tropicalis)
Sequence
XKKRLAKQNADLPTANPNVSSESTQMDDTIKGILEQLPEKVAEDDKKKKRKEGKQLRRSE
IKKHVSVWENQNNKNVKKEKKMVTRRPLGTIEYTATGTDTLNSIALKFNLTPNKLVELNK
LFTHTIVPGQILYVPDSSVASIARDPKANAGILASPLSSDAEYDKLPDADLARKASKPIE
RVLSSTSEEEEPADVKFIKMNCRYITDGKGVVGGVMIVTPNNVMFDPHKSDPLVIENGCE
EYGLICPMEEVVSVALYNDISHMKIKDALPSDIPKDLCPLYRPGEWEDLSSEKDINPFSK
FKNLSKEKRQQNGVSGQSIAENKLITTSSKDLDLIKITTELEPKNGSDGQLSPVQLTVDE
RLAIQTDQSIENITSSRTKKADNSPVEDDFIELVATTAEANCKNNYKESENHTVVGEAIE
HSMFQNDIPCNNSESNRTVDVICPVEQISDPVKRICLVSDKTETTSDSDFIQTLQQSKNI
ELCLSPAEKNKLDICGFQRSDLDNSGDEGKVMSCINLEPKNITEVTTVTQNVENKLSKPE
EKASEESVDSLSPSSPEVPSQKETLMDSESELKLWLIKRMQRPIEDLFPSKEEKSKVPPM
FLCIRVGKPMRKSFASQSTAVVQQYIRRRKQPEYWFAVPQERVDHLYNFFVQWSPEVYGK
DAKEQGFVVVEKDELNMIDNFFSEPSTKSWEIITVEEAKRRKSTCSCYDDDEDEEETLED
FLPDLKQKSVLLDDMQVEKLAHNLPARVQGYLWHLVYSTQEHGTSLKTLYRNLATVDSPV
LLVVKDMDNQVFGAYATHPFRLSDHYYGTGETFLYTFCPDFKVYKWSGENSYFINGDISF
LGLGGGGGRFGLWLDSDLYHGRSNACCTFNNDTMSKKEDFIVQDIEVWAFE
Download sequence
Identical sequences 8364.ENSXETP00000025577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]