SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000029514 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000029514
Domain Number 1 Region: 10-162
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.47e-27
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 
Domain Number 2 Region: 189-265
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.01e-26
Family GAS2 domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000029514
Sequence length 857
Comment (Xenopus tropicalis)
Sequence
GGSVRSIRPFKSSEEYLYAMKEDLAEWLKDMYNLEVFVDNFIEILGNGSVLCQHANNVTE
VAREFAVQYPHLAEKLQLPKSGVKLNMMAQPGTFLARDNVSNFIQWCRKEMDIKDVLMFE
TEDLVLRKNEKNFVLCLLELARRASRFGMSAPMLIQMEEQIEEEIREEMDLPPQEIPVPK
PQRKLCDFKNLDQMVQHLVSRCTCPVQFSMIKVSEGKYKVGESSTLIFVRILRNHVMVRV
GGGWDTLEHYLDKHDPCRCTSLSHKPAIKLGSLQKQLSAVHEVKTRLTPRLDNPSKLETT
LIVSRSQSPLPPVEWRTYSSGRSRTLSSTAVPQRTLARKKTLSTEMKGSKPKQLPSQRGL
KPKRSLKKPERVPSIYKLKLRPKIRPRRDNRPEKKASRIPTPVSYRQALSRKNSKALKRT
QSYQAKDSRPKTPSRFIRPPSPSKQIHFVQNQQSKGLEQNPKAQTIGYTRSPSPVKQTNL
TYSRRPATPSRISCGSSQYKETDKSVANEIITSNNYVKTKPSVSSEMQSEHKVSNLPLRM
QRKPEAIETSQSIERDCMYTPLPIDPEQEKQIYRSLEDEILTNIKVLEGLCTLKKPMGQE
GVPRSGVYINTTWQSGASYDDVITELTKGHVKLNRVDVENWISKIPSKGIRNKVCENGHS
AAVPQRTLARKKTLSTEMKGSKPKQLPSQRARQLALENKKKMVENVSENQASTVSGNSED
AVEEKIKLPQGLKPKRSLKKPERVPSIYKLKLRPKIRPRRDNRPEKKASRIPTPVSYRQA
LSRKNSKALKRTQSYQAKANNTSPAQNLNESKSSVVISEDVVSDDETCENSVPLQAEAPL
NVGNSQSRTDEEEESWV
Download sequence
Identical sequences 8364.ENSXETP00000029514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]