SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000031040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000031040
Domain Number 1 Region: 13-126
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.14e-35
Family Calponin-homology domain, CH-domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000031040
Sequence length 224
Comment (Xenopus tropicalis)
Sequence
MSVMLWRWEQNNATMKLIYTDWANHYLAKSGHKRLIKDLQQDVTDGVLLAEIIQVVANEK
IEDINGCPKNRSQMIENIDTCLSFLAAKGINIQGLSSEEIRNGNLKAILGLFFSLSRYKQ
QQSQKQPQQYQPAPQLYQPPSTPHAQPHPAAPLQCQQPQQPPHPQTKAQADMHSRLPAPS
ARAMAAGTENKSRGQTGGSRRSQSFNNHEKAKPLNSPATVNDKG
Download sequence
Identical sequences F7C2D7
ENSXETP00000031040 8364.ENSXETP00000031040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]