SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000039259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000039259
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.16e-34
Family Calponin-homology domain, CH-domain 0.0000432
Further Details:      
 
Domain Number 2 Region: 182-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000539
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  8364.ENSXETP00000039259
Domain Number - Region: 214-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000224
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000039259
Sequence length 958
Comment (Xenopus tropicalis)
Sequence
MAAIKALQQWCKQQCDGYRDVSITNMTTSFRDGLAFCAILHKHRPDLINFDLLSKENVYD
NNHMAFSVAEEKLGIPALLDAEDMVKLRVPDRLSILTYVSQYYNYFHGRSPIGGLAGVKR
PPPDTVEEPAGKKVTNDVLPTPQATSRAPQPVPRTNVPVLKSNTVIENPPVRAGIREIDS
NSSVSSNCMICGKHVHLVQRHMADGKLYHRNCFKCKQCSRTLQPGQYKAGDGLGSFICTN
HHIAVPTSPVTRTIMPAAPHGATVDEKKSSWVTPRSAVLDQNNKTPGNRFDHSGLGTGAV
QDPTNRTAVGFVSNNQKLQHSTGAPAQEDKPSRNILNSPYSSSSTSTAVGFGNSIKDNSS
TITIGSNQQNKVDNNYLNTSRSVAHEQPKKPSSDLLTHKGKSEPQKDPLPSNQQIKSPNF
TINSISAGRMTTLVTKDEPKETSPKPWELSAAKNKAARERFFQTSPAVVEPANKVSSRDV
VSPKSSDGPGKSTASSLSPGITDSSTEKDNARNYLLKTLGGPTSPKPSGEAENPSPVYRP
HRLLNEKTADPSNSSTKVEPARPVPKERKNKNDTAKAVLNPEPLLTTPTYSSKGITTPST
GNISYLSKSGPGQRAEEISSKGPVPNSNVSKQETPENWRQNLKPIAKTPQTPGVVQPKVY
PLPKDVENAAKTTPSPQKTPTIINSVKTTLNFPGKENKPSECLTPPAAKSKEDKASSSPT
PPRKKLLPVNLDLINDWPKPVQKWQDVSLKDDTKRPAEHVQGIGRKEDGSPFNKARPEYI
PEEEIQRQLQIIEQELDALEQQGVEMEKQLRSCDGDESEDTLMVDWFKLIHEKQLLLRQE
SELNYISKQQALEDKQSNVDTELRNLMNKPDDLKTPADREREKQLLDQLLVIVNDRSGIV
ECLDEDRIREKEEDEIMEAMIQRHSENHQKEASPEPNLKRRSRFSFSGLFKPKDKSKT
Download sequence
Identical sequences 8364.ENSXETP00000039259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]