SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000053965 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000053965
Domain Number 1 Region: 63-98
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000000206
Family GLA-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000053965
Sequence length 104
Comment (Xenopus tropicalis)
Sequence
MKTLPVILLLALVAVVALAYDSYESHESLEVYDPFLNSRKANSFMNSQAKNQRMNERIRE
RNKSPRERQREACEDYDPCERYALRYGFSAAYKRYFGQRRGEKK
Download sequence
Identical sequences gi|301612298|gb|XP_002935654| 8364.ENSXETP00000053965 XP_002935654.1.99540 XP_004913962.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]