SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000054912 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000054912
Domain Number 1 Region: 1-131,165-274
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.09e-67
Family Calponin-homology domain, CH-domain 0.0000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000054912
Sequence length 275
Comment (Xenopus tropicalis)
Sequence
ERENVQKRTFTRWINLHLEKRNPPIEVKDLFVDIQDGKILMSLLEVLTGQSLLQEYKPSS
HRIFRLNNIAKALKFLEDSNKDSFPQSHVKLVSIDAAEIADGNPSLVLGLIWNIILFLQI
KELTGNLNRMSSSSSLSSLPSGPDSDSSHSSTPSTEKSLSVSIKDQRKAIKALLNWVQQR
TKKRYGVAVQDFASSWKSGLAFLALIKAIDSRLVDIKQALVKTARENLEDAFRIAQEELS
VPRLLEPEADVMVNSPDEQSIMTYVTQFLEHFPEL
Download sequence
Identical sequences 8364.ENSXETP00000054912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]