SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8364.ENSXETP00000055099 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8364.ENSXETP00000055099
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-50
Family Calponin-homology domain, CH-domain 0.000000185
Further Details:      
 
Domain Number 2 Region: 222-282
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 8.37e-21
Family EB1 dimerisation domain-like 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8364.ENSXETP00000055099
Sequence length 296
Comment (Xenopus tropicalis)
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGSVYCQFMDMLFPGSVVLKK
VKFQAKLEHEYIQNFKVLQAGFKKMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQESAPVPVLAAPVLNKPKKPLGSGNTDESFAGGSEGKATRTEPAPGLK
KMAKIAPQRTVPVQRTAVSNKPPAQGISKKPATVGNGDDESAELIQQINVLKITVEDLEK
ERDFYFGKLRNIELICQENEGESDPVLQRIIEILYATDEGFVIPDEGAPPEDQEEY
Download sequence
Identical sequences 8364.ENSXETP00000055099 XP_012827054.1.99540 XP_012827055.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]