SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 85963.jhp0540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  85963.jhp0540
Domain Number 1 Region: 17-201
Classification Level Classification E-value
Superfamily HAD-like 0.00000000000357
Family HAD-related 0.052
Further Details:      
 
Weak hits

Sequence:  85963.jhp0540
Domain Number - Region: 273-312
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0153
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 
Domain Number - Region: 332-397
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0497
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 85963.jhp0540
Sequence length 591
Comment (Helicobacter pylori J99)
Sequence
MRKFLDGAKSEVLKYDVISFDIFDTLLLRPFIKPTDLFLYIETKYNIKGFHQARILAEMQ
SRKLSKRQDITLDEIYHQIPKEFHSYKGVEIATEKEVLVPNLEMLELYRFAKENNKRVII
VSDMYLPLEVLEDILISKGFDGYTNFYLSNHIMLTKHSKDLFKHVLKQENITNTQILHIG
DNSWADDAMPKSLGIATLFRKSVLKQLEEVFPKYKTFNPTSVAQSFILGSLCVFYKNYIQ
KHEKFDYWFLLGAMQAGIAAVAYCQFIYKEIHKRNIDTLVFVARDGYLLQKIFNILYPNS
YKTTYVYAPRILKKAVFLEVVEGESLEILRILEGEEEVKKKQITTNQQAYVYLYSNFEHC
RHLALKCLDNYRKYLFSSNLEGNIAIVDTITLGYSSQGLIQKALNKEVFGCYVDLLRILN
YDCVSFLPFSHPKPVYFHNWDFMEFLLTSPEYPILNVENGVPIYQKDVSSCEKHRSKAYE
KIVEGAVGYASYFKESQISLDIHDVIEWVNFFIDNPSIQDQEQFKQIYFLPDATHKNALP
LFCNDVSLLSCILKPSQSYSVLKRSLRTNKQERLFKILSLIKKIYGKLKKK
Download sequence
Identical sequences A0A1W0VN48 Q9ZLN8
WP_001224732.1.101339 WP_001224732.1.2208 WP_001224732.1.30177 WP_001224732.1.31181 WP_001224732.1.37060 WP_001224732.1.88069 85963.jhp0540 gi|15611607|ref|NP_223258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]