SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 882.DVU1211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  882.DVU1211
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily L28p-like 2.16e-25
Family Ribosomal protein L28 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 882.DVU1211
Sequence length 69
Comment (Desulfovibrio vulgaris Hildenborough)
Sequence
MGKQCEVCGKKPQVGHHVSHSNIKTKRRFEPNLQSVRHQLPSGEVKTVTVCTRCLRSGAV
TKPVVRKSA
Download sequence
Identical sequences A0A0E0T163 A1VEJ7 Q72CS2
gi|120602890|ref|YP_967290.1| WP_010938507.1.14085 WP_010938507.1.63145 YP_010430.1.77684 gi|387152982|ref|YP_005701918.1| gi|46579622|ref|YP_010430.1| 391774.Dvul_1846 882.DVU1211 DvR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]