SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 882.DVU2641 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  882.DVU2641
Domain Number - Region: 127-149
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0107
Family Integrin alpha N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 882.DVU2641
Sequence length 244
Comment (Desulfovibrio vulgaris Hildenborough)
Sequence
MRTTHRIAIMLLSLVLSGCAMQQPVEVLRPDEFSTMATRLRTELVRRGLLDENGAYEPGL
PMNSHGEYRPASFGEELYKRLSTRFRMPDAATGGLTPETFAASASPRDDVRIGKGGFVMA
QGMDIITVSIIAVTDWNGDGVNDWLLVCRVKPLLGNGPRDYYLAVDNVTAEGVLQPKIIA
IYDCQDGTCVLVTGKARKDVLGFDPEHPYVDATPGDQVTLPPGSPAPTGGVHEDRRVEEQ
SLAN
Download sequence
Identical sequences A0A0E0T4W6 A0A0H3A6D6 Q728G2
391774.Dvul_0609 882.DVU2641 gi|120601659|ref|YP_966059.1| gi|46581045|ref|YP_011853.1| WP_010939910.1.14085 WP_010939910.1.63145 YP_011853.1.77684 gi|387154284|ref|YP_005703220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]