SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000004801 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9031.ENSGALP00000004801
Domain Number - Region: 70-104
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00484
Family F1F0 ATP synthase subunit C 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000004801
Sequence length 104
Comment (Gallus gallus)
Sequence
VGATPKRPATPFLIRAGSRILYRPISASVFSRPEVRTGEGKSTRNGAQNAVSQLALREFQ
TRAVSRDTDTAAKFIGAGAATVGVAGYGAGIGTLFGSLIIGYAR
Download sequence
Identical sequences ENSGALP00000004801 9031.ENSGALP00000004801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]