SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000005592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9031.ENSGALP00000005592
Domain Number - Region: 34-102
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00178
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 
Domain Number - Region: 791-856
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0108
Family Mevalonate 5-diphosphate decarboxylase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000005592
Sequence length 873
Comment (Gallus gallus)
Sequence
MGSAEGTDWVDVANDLLRSCHVNQHIKHLSECGADVFVRLYESILGERVPDFIATPRSQE
DDAHNVQAVIDSLALDYLQVSLSHITGENIVKGERESIRNLLEIFDGLLEYLTEEGSESS
SQNGDETHVVPNSKIQVVSPEQLESNAGQLLPPLKLSSVDGSQSECFVPLYDVDGLESTS
ELIQLGDTAHSFSERGEVKSYLCKSRNTDLLKQLMRRLNSVQSNKYGNQHLIFNLPSNMR
GCSSAQRLREPICQAVPLLPPFQPAEARSCDPVHRDHQSLDSQSAALVNSQELESPTLET
QTSEGVSGALLSRKIPGESEFCFLQNNSMCQTLPLILFVVQLLFLLFCGTSGLLGFSRQW
RSTVSNAVLLDNGYIQFTSHISSFVFVFCRYENSTIDSLEEPLSHRTTKENLSKQELHQV
SQKLSHRLNELDAMLKRALGGRTREEVTDEDNMSQHSDSVMDYRRRRTERDIPHLKYPSR
TRSLSPSSPSTQHQRFSESGDILCSNGKGQVKKIRNKLQKEKDERTQEAKRIAKAYENEL
RIYEAQERLRLSKLREEVKELEQEYKENIFKESPKIPQPVKVYSRKTTPWNPRYSQWIPK
RGTVKPKKAAPMKVRDDDLLVQLLEEFPHLHISQHTMNKMWRQQLAQTEQLKAASGRARL
KLQNEVQQALKKHELLVAIIKKDRDHNKRLQEFKQRIYRQKWTQNKVREKRQQVARARKY
YEDYRVQLRAKMMRARTREERIFKNLFEEGLEIQKQRLKDLRAYAQEMRAEQRREHQNEL
ESMENYYRDQFSMLAEAVSRERQEIQTREKAQTQMLQKTKRELRSRMEKEIQQLQTAIMQ
NDDETFFQELEADRLRSRLQMASFQYNKTVCRE
Download sequence
Identical sequences 9031.ENSGALP00000005592 ENSGALP00000005592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]