SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000005781 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000005781
Domain Number 1 Region: 27-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.4e-30
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 203-282
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.67e-30
Family GAS2 domain 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000005781
Sequence length 315
Comment (Gallus gallus)
Sequence
AMYTALSPKTRGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGREITAETFMEK
LDNGALLCRLAETLQEKFKEKSFEANKPGKTLPVRKIPCKANAPSGSFFARDNTANFLSW
CRDVGVDDTCLFESEGLVLHKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEIEQEETL
SAPLPSPSPSPTKSPGKKSTGKLLDDAVKHISEDPPCKCPNKFCVERLSQGRYRVGEKIL
FIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLRDMNPDN
YLVVSAHYKTKKEIK
Download sequence
Identical sequences ENSGALP00000005781 9031.ENSGALP00000005781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]