SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000005847 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000005847
Domain Number 1 Region: 62-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.89e-86
Family Calponin-homology domain, CH-domain 0.000001
Further Details:      
 
Domain Number 2 Region: 4205-4363
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-30
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 3216-3376
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-29
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 4 Region: 4642-4791
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-27
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 3327-3479
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-26
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 310-426
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-24
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 7 Region: 5154-5230
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.27e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 8 Region: 3762-3920
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-23
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 9 Region: 4445-4583
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-22
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 2780-2936
Classification Level Classification E-value
Superfamily Spectrin repeat 2.34e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 4861-4987,5014-5045
Classification Level Classification E-value
Superfamily Spectrin repeat 4.26e-22
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 12 Region: 4004-4145
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-20
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 13 Region: 2449-2572
Classification Level Classification E-value
Superfamily Spectrin repeat 6.36e-18
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 14 Region: 4328-4435
Classification Level Classification E-value
Superfamily Spectrin repeat 9.81e-18
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 15 Region: 3437-3581
Classification Level Classification E-value
Superfamily Spectrin repeat 1.34e-16
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 16 Region: 5065-5145
Classification Level Classification E-value
Superfamily EF-hand 7.12e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 17 Region: 2995-3155
Classification Level Classification E-value
Superfamily Spectrin repeat 8.06e-16
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 18 Region: 3545-3667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000537
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 19 Region: 1225-1351,1378-1404
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000075
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 20 Region: 670-788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000916
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 21 Region: 1757-1880
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000568
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 22 Region: 2691-2792
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000173
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 23 Region: 2356-2464
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000996
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 24 Region: 1889-2001
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000157
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 25 Region: 3654-3773
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000016
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 26 Region: 2217-2320
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000633
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 27 Region: 3924-4032
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000109
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 28 Region: 2578-2699
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000547
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 29 Region: 591-681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000694
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 30 Region: 2000-2106
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000111
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 31 Region: 750-865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000114
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 32 Region: 1498-1656
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000302
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 33 Region: 2095-2210
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000082
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 1422-1536
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000275
Family Spectrin repeat 0.0066
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000005847
Domain Number - Region: 1047-1156
Classification Level Classification E-value
Superfamily Spectrin repeat 0.048
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000005847
Sequence length 5415
Comment (Gallus gallus)
Sequence
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLVSLLEVLS
GVKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYIGVKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEIAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISAIEVDSRWLEYQTRLESLISWIKQHTILMSDKSFPQNPVELKALYNQYIHFK
ETEIPAREQEKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKLLR
PAVERLELLLQIANKIQNGALSCEEKLTLAKNTLQADAAHLEAGQPVQYEADVVVYLQEC
EGLIRQLQVDVQILRDENYYQLEELAFRIMRLQDELVTLRLECTNLYRKGHFSTLELAPA
PTLSTTQLKGESLTKGLHTSSASWFRKPMTRTELVAISSSEDEGSLRFVYELLAWVEEMQ
MRLERAEWGSDLPSVETQLETQRHIHSSVEELGSSVKEARLYEGKMSQNFRASYTETLGK
LETQYCKLMETSSFRLRHLQSLHGFVSRATAELIWLNEKEEEELAYDWSDNNPNIAAKRN
YFSELTMELEEKQDIFRSLQDTAELLALENHPAKQTVEAYSAAVQSQWQWIKQLCLCVEQ
HVKENAAYFQFFSDARESETYLRNLQDSIRRKYSCDHSTSLTRLEDLLQDSMDEKEQLIQ
SKSSVASLVGRSKSIVQLRPRNPEHLVKSTIPIKAVCDYRQIEITICRNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKEAIEMANRVEQLYQKVMALWHQLHMNTKSLISW
NYLRKDIALVQSFSMEKLRSLAQGECQQALRSLQAHYEDFLQDSRDSELFSVSDRLRLEE
EVESSKEHIQQLLQSMENEDKDETVARTYLSELQNIRLRLEECEQRLVSRIQSPSSTRAD
GDSIQENTIRIAEQERMQEDLQQLKSDLRCVSERCYSFLNRAPGGPSTPRLRSELDLVVN
KMEQTYGLSSVYLDKLKTVDIIIRNTQGAESLVKGYEVKLSQEEAVPADLTAIQAHRSAL
QQWLGEVKGKNSVFSMLEEEMAKAVGEQLYQLRQERSIDLERYQEKGSQLWDRWQRACTQ
IETRHTELESIQEVLSDYRQCHRALIQWIEEITAQQELMKPGQAEDSRVLSEQLSQQTAL
AAEIEKNQAKLDQCQKFSQQYSAAVKDYELQLMTYRAFVESQQKSPMKRRRMLSSSDAIT
QEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVDKVKELLGWAVGLK
QSVQGRTAAAQSRELGDIKKSISEQQALNEELAAKKEQVSEAIKTSQIFLAKHNHKLSHQ
EKDQISAQVAALKDAYQTLCTDTTEQLQQLQSQLAQETEHKTLQEQQAARAQNLAELSSW
LAAAEDTLVEQQRAASQGDLPALQQRQSDVKELQRSMHSRAASFASVLKSTEEFLEENKA
KMEPGELAVLQEKLQRAKEQYQSLQERTEMAQKELESAVTAAVQQETEKVKAAKELQENS
NKIDALLSWVASLEQKRELPQYRPHPAERAGKGAGDIPDGHMVGAARTAESLDEQYEGLK
AQHQELLSQQQDIILVTQAAQAFLDKHGHSLPGEERARLQGGLAELKERYAASLARSEVQ
LKQVQVLRDELQKFLRDHGEFEAWLKQAEQDLEGMCKGDSDPASLRQLLLRQGSFSEDVI
SHKGDLRFITMSGQKVLDAEGAAGDAGSSGSVVKSKLEDASQRYTTLHSKCTKLGSHLST
LLDHYQQFQEVAESLRTWLEDSEAAVGKLLSESVSSDPTALQEQLASAGQQLQGNLAEHQ
VPVEKLQKAARSLLEVQGEPAPDHGHIRETTDAIVSRFQSLSQQMAERSDLLQKSIAQSQ
SVQESLENLLHSVADIESSLSAEQPGALSSAAIQDSLATSAKLKQDIARQRSCLEATREM
VTRFAETADGGTAAALQGKLAEATERFGKLCQQQQEKEEVLKGLLPKVEQYEQLSEKLQQ
FMESRARMLASGNQPERDIARFSQHLQELNVEMGQHQEDLAALEQLAVELGASGFVPGAA
AQQEKLQNLKEEFLQLQKVAKERERDASSCQEQLDEFRRLVAALRRWLKDSEGKVPPVDT
SLGTQELQRRKQRVQELLEEWSGKGPQVEELSHRGTLLENLIVEITAPDSQTKAGSVLPA
VGGPLGSVNGFHTCKVDLTEIQCDVSDVSRQYEGLGAALRERLQQLSAMLERMQAVQEEA
GAVLQWLESKERTLSELEASSSPTKTETMRAQAEHNKAFLAELEQNSGKIQKVKEALSGL
LEKYPDSPEAANWKKMQEDLNCRWERASQATAERQQKLEESANQLASFQAAEAQLRPWLM
EKELMMSVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNQAAQSILTGPGDVSPS
TNQVREELQGVNQKWSELTERLNSRSSQIDQALVKSTQYQELLQGLSEKVKAVGQRLSSQ
SAVSTQPDAVKQQLEETSEIRSDLEQLEEEIAEAQTLCDDLSVLIGEQYLKDELRKRLET
VALPLKGLEDLAADRMNRLQTALASSQQFQHMFDELRTWLDDKLCQQARSQPISARLERL
QSQIQEQEEFQKSLNQHSGSYEMIVAEGESLLLSVQPGEEKTALQNQLVSLKAHWEELSK
QAADRHSKLKDCLQKAHKYQRHTEDLLPWVEDCKAKMSELEVTLDPVQLEAALLRSRALL
SDVEKRRSLLEMLNGAADVLIDASQCDEDDIRDEKAAINQEMDAITEELQAKTGSIDEMS
QRLKEFQESFRNIEKKLEGAKHQLEIFEALGPQACSNKNLEKLRAQQEVLQALEPQVDYL
KHFTRGLVEDAPDGSDCSQLLGQAEVAQEEFKAMRQKVNDCCVLMENKLEGIGQFTSRVR
EMFSQLADLDDELDGMGPTGRDTDSLQSQAEDIRTFLGKLQALKADIEASESECKTMLED
EGSPDLLGLKRELETLSKQCSKLTERGRSRQEQVETTLARVEDFYGRLRELTHMTTAAEE
SEALQWVVGTEVDTINQQLADFKLFQKEQVDPLQLKLQQVNGVGQGLIQSAGKNCDVQGL
EHDMEEINTRWNTLNKKVAQRIAQLQEALLRCGKFQDALEPLLSWLTDTEELISNQKPPS
AEYKVVKAQIQEQKLLQRLLDDRKATVEMIQAEGGRIAQSAEPADREKITGQLQSLESRW
AALLCRAAGRQKQLEDILVLAKQFHETTEPVSDWLSVTEKKLANSEPIGTQTAKIQQQIS
RHKALEEDIEGHAADVAHAVRVGQALSALSCAAEQRLLAEKLESLQGRYGEVRERCCRKA
ALLEQALCNARLFGEEEVEVLNWLAEVEDKLGSVSVKDYKRDVLQKQHADQLALNEEIVN
RKKNVDQAIRNGQALLKQTTGEEVLLIQEKLDGIKTRYSDITAASSKALRTLEQARQLAT
KFQSTHEELNAWMSKVEDELASSGGQSPASEQIPQFQQRQKELKKEVMEQRLVLDTVNEV
SRALLELVPWRAREGLDKLVSDTNERYKLVSDTVRQRVEEIDAAIQRSQQYEQAADAELA
WVAETKRKLMALGAIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSQRNEIFGTCGEE
QKAVLQEKTESLVQQYEAVSQLNSERYARLERAQVLVNQFWETYEELSPWIEETQALISQ
LPPPAIDHEQLKQQQEDMRQLRESIAEHKPHIDKLLKIGPQLKDLNPEEGEMVQKKYSTA
EAMYAKIKEEVCQRALALDEAVSQSTQITEFHDKIEPMLEALEALSSRLRMPPLIPAEVD
KIRECISENKNATVELEKLQPSFEALKRRGEELVGRSQGADKDLAAKVIQDKLDQMVFFW
EDIKARAEEREMKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPSIIKQQVE
AAETIKEETDGLHEELEFIRLLGTDLIFACGETEKPEVKKSIDEMNNAWENLNKTWKERL
EKLEEAMQAAVQYQDTLQAMFDWLDNAVIKLCNMSPVGTDLNTVKEQMNEMKEFKMEVYQ
QQIEMEKLNHQGELMLKKATDETDRDIIKEPLTELKHLWENLGEKIAHRQHKLEAALLAL
GQFQHALAELMAWLTHTEELLDAQKPINGDPKVIEVELAKHHVLKNDVLAHQATVDTVNR
AGNELLESSAGDDASSLRNRLEGLNACWEAVLQKTEEREQQLQSTLQQAQGFHGEIEDFL
LWLTRMESQLSASKPTGGLPETAREQLNAHMELYGQLKAQEDVYSQLLAKGRLMLLNRDD
SGSGSKTEQSVALLEQKWCLVSTKMEERKAKLEEALALATDFQNSLQDFINWLTLAEQSL
NIVPPPSLILNAVLAQIDEHKVFANEVNAHRDRIIELDQTGNQLKFLSQKQDVVLIKNLL
VSVQSRWEKVVQRSVERGRALDDARKRAKQFHEAWKKLIDWLEDAENHLDSELEISNDPD
KIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKALLPDDTQKLDNLLGEVRDKWDTV
CGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHK
VFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKVQLQELSNRWDTVCKLSVSKQSRLE
QALKQAEEFRTAVHMLLEWLSEAEQSLRFRGALPDDAEALQSLIDVHKEFMKKVEEKRVD
VNTAVGMGEVILSACHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLEAALSELVANAE
LLEELLAWIQWAETTLIQRDQEPAPQNIDQVKALITEHQSFMEEMTRKQPDVDRVTKTYK
RKATEPPHGALIDKSRSNRKSLTQAAPPTMPIISQSETKNPRINQLSARWQQVWLLALER
QRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEF
IDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKIEDEV
TRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKND
PCRARGRTNLELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCA
SMPSSPATPASGAKVTPAAGSKLKRPTFHSSRTSLVGDTSNSSSPVSSGAKSGRADPKKA
ASRPTSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSVAGTRRGAKPSKIPTMS
KKTTTATPKTPGPKR
Download sequence
Identical sequences 9031.ENSGALP00000005847 ENSGALP00000005847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]