SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000008717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000008717
Domain Number 1 Region: 4-168,214-324
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-50
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000008717
Sequence length 326
Comment (Gallus gallus)
Sequence
SELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRNDPKLQELMKVLIDWIN
DVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINE
TLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQ
SRQIQEEITGNTEAFSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTEL
ETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRP
EDIVNCDLKSTLRVLYNLFTKYRNVE
Download sequence
Identical sequences 9031.ENSGALP00000008717 ENSGALP00000008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]