SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000009440 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000009440
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily L domain-like 5.02e-26
Family Leucine rich effector protein YopM 0.058
Further Details:      
 
Domain Number 2 Region: 498-607
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.41e-26
Family Calponin-homology domain, CH-domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000009440
Sequence length 618
Comment (Gallus gallus)
Sequence
MLTYLNISRNLLSTLPKYLFDLPLKVLVVSNNKLVSIPEEIGKLRDLMELDISCNELQVL
PQQIGKLQSLRELNIRRNNLHMLPDELGDLPLVKLDFSCNKITEIPICYRKLRHLQVIVL
DNNPMQIPPAQICLKGKVHIFKFLSIQACLRIDKKPDSLDLPSLGKRIPSQPLTDSIEDF
YPNKNHGPDSGIGSDNGDKRLSTTEPSDDDTISLHSQVSESTREQTLRNDNHVMGNKLDP
QKDQEVYDYIDPNAEEGAVPEQGDVQIGPLLSYINLNKERGKHPEKSQKIEHHEDWGDEK
RLQKEQLLAEEDDEIKEVTDLRKIAAQLLQQEQKHSYLFRLLNHSASVSTRNRPKQPVES
EKCISTDEVNSPVSPYSWQPLENQKDSVDDQRWPETQPIIWQNEERRRSKQIRKEYFKYK
SSRKSSSGNENDEQDSDNTNVSPQSPVSSEDYERSDSNTHGPFGLKPRSAFSRAARQDYG
AMDPGFTMRRKMEHLREEREQIRQLRNNLESRLKVILPDDIGAALMDGVVLCHLANHIRP
RSVASIHVPSPAVPKLSMAKCRRNVENFLDACKKLGVPQERLCLPHHILEERGLVKVGLT
VQALLELPTLKVSQLSAM
Download sequence
Identical sequences ENSGALP00000009440 9031.ENSGALP00000009440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]