SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000010741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000010741
Domain Number 1 Region: 1014-1118
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.03e-30
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000010741
Domain Number - Region: 686-749
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0994
Family HLH, helix-loop-helix DNA-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000010741
Sequence length 1120
Comment (Gallus gallus)
Sequence
MKKASRSVGSVPKVPGVNKTQTTEKTKPESGSSLSAVTKLSKPGTSASLLKTKSNDDLLA
GMASGGGVTMTNGVKAKKSTCASTVSSTTGTTMSTLENKPRTVAETGSTARRSTSSGTKE
SSSSRERIRDRSRLSQSKKLPLAGQGSNDTVLAKRSRSRTNPESDIRMSKSKSDNQISDK
AALEAKVNDLLTLAKTKDVEILHLRNELRDMRAQLGLNEDQVEGDEKSEEKEAIVVHQPT
DVESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPE
ITAGNHSDGGGTLTSSVEGSAPGSMEDLLSQDEHTLMDNQHSNSMDNLDSECSEVYQPLT
SSDDALDAPSSSESEGVPSIERSRKGSSGNASEVSVACLTERIHQMEENQHSTAEELQAT
LQELADLQQITQELNSENERLGEEKVILMESLCQQSDKLEHFSRQIEYFRSLLDEHHISY
VIDEDMKSGRYMELEQRYMDLAENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGAL
KERNHHMERIIESEQKSKTAIASTLEEYKATVASDQIEMNRLKAQLEHEKQKVAELYSIH
NSGDKSDIQDLLESVRLDKEKAETLASSLQEELAHTRNDANRLQDAIAKVEDEYRVFQEE
AKKQIEDLNVTLEKLRAELDEKETERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENT
VKKLQDQKHDMEREIKNLHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRR
LHEAQEKNEKLTKELEEIKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEP
TPTVKTLIKSFDSASQVPSPAAATIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISASKP
LATLTDKRPSYAEIPVQEHLLRTSSTSRPASLPRVPAMESAKSISVSRRSSEEIKRDISA
PDGASPASLMAMGTTSPQLSLSSSPTASVTPTTRSRIREERKDPLSALAREYGGSKRNAL
LKWCQKKTEGYQNIDITNFSSSWNDGLAFCAVLHTYLPAHIPYQELNSQDKRRNFTLAFQ
AAESVGIKSTLDINEMVRTERPDWQNVMLYVTAIYKYFET
Download sequence
Identical sequences ENSGALP00000033238 9031.ENSGALP00000010741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]