SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000012286 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000012286
Domain Number 1 Region: 18-88
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.46e-17
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000012286
Sequence length 103
Comment (Gallus gallus)
Sequence
SPANDPADTRVRQNSKQREEELELIEQLRKNIESRLKVSLPSDLGAALTDGVVLCHLANH
VRPRSVPSIHVPSPAVPKLTMAKCRRNVIPPLVKEGTLVAWLK
Download sequence
Identical sequences ENSGALP00000012286 9031.ENSGALP00000012286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]