SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000013240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000013240
Domain Number 1 Region: 15-281
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2194-2310
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-37
Family Pleckstrin-homology domain (PH domain) 0.00000275
Further Details:      
 
Domain Number 3 Region: 297-418
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 1013-1167
Classification Level Classification E-value
Superfamily Spectrin repeat 7.52e-30
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 5 Region: 1541-1697
Classification Level Classification E-value
Superfamily Spectrin repeat 1e-29
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 6 Region: 1225-1378
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-28
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 7 Region: 642-745
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-27
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 8 Region: 1860-2014
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 813-953
Classification Level Classification E-value
Superfamily Spectrin repeat 5.83e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 427-530
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 1700-1805
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-23
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 12 Region: 531-639
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 13 Region: 1386-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 7.49e-18
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 14 Region: 2019-2080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000331
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000013240
Sequence length 2364
Comment (Gallus gallus)
Sequence
LRMTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKK
TFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDK
ALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDA
LLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAF
NLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAI
ETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTE
KGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQE
KLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERV
QAVVAVAKELETENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEML
YIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDG
EGYKPCDPQVIRDRVAHMEFCYQELCQLSAERRARLEESRRLWKFFWEMAEEEGWIREKE
QILSSDDYGKDLTSVVRLMSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEENFGSEKIRER
IKDIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYS
TQSLVKKHKDVAEEIASYRPTIDSLHEQAKALPQEHAGSPDVQGRLSGIEERYKEVAELT
RLRKQALQDTLALYKMFSEADACELWIDEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEM
NNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALISALSIQ
NYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKE
AEKLESEHPDQAQAILSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWL
SRTQTAIASEDMPNTLTEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYM
FLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMP
TTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHR
KNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQA
FMAELASNKEWLEKIEKEGMQLIAEKPETEAVVKEKLTGLHQMWEELESTTQTKAQRLFD
ANKAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEE
LQSQARALSQEGKSTDEVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVEDEI
LWVGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSPN
AEAIQQRLADLKQLWNLLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMMSEE
KAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKL
YAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQER
FREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQ
ILAASYELHKFYHDAKEILGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQ
VRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSM
VRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLA
RKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPY
LSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEERKRK
PPTPEPSPKVAEDGGSQQQWDGTKGEQVSQNGLPSDQESPRVAETAETNEMVNGAAEQRT
SSKESSPVPSPTADRKAKAAIQAQTAATLPAKTQEIPSAQMEGFLHRKHEWETHNKKASS
RSWHNVYCVINNQEMGFYKDSKAAASGIPYHNEIPVSLKEAVCEIAVDYKKKKHVFKLRL
TDGNEYLFQAKDDEEMNTWIQAITSAISSDKIEVSPTTQSTPASSRAQTLPASVTITSES
SPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences ENSGALP00000013240 9031.ENSGALP00000013240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]