SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000013987 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000013987
Domain Number 1 Region: 976-1103,1135-1341
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-77
Family p120GAP domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 40-204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.16e-39
Family Calponin-homology domain, CH-domain 0.0000189
Further Details:      
 
Domain Number 3 Region: 1566-1663
Classification Level Classification E-value
Superfamily RGC domain-like 7.45e-33
Family RGC domain 0.00000176
Further Details:      
 
Domain Number 4 Region: 638-841
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000239
Family Nucleotide and nucleoside kinases 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000013987
Sequence length 1663
Comment (Gallus gallus)
Sequence
DQRSAMAAEEMDGLGMSRPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEA
CLNEELPPTTELEEGLRNGVYLAKLGNFFSPKVVSVKKIYDREQTRYKATGLHFRHTDNV
IQWLNAMAEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVD
FTEEEISNMRLELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDHQVPADT
LVAMKNPNAMLINLDDDLESTYQDTLYRAKKDKMENAKNRISSENSERERDVYEELLTQA
EIQGNINKVNTCAAISKIDLALEQGDALALYEALATPALGLRGLLRENCDWYFKQFLSDR
QQKQEAGIAGVLQKEDLQLGVDAANRAAQQYQQRLAAVTRINAAIRMGDAEKTVAEMMNP
EAQLPEVYAFAANLYQKELATLQQQSHDGNLTHAELSVAVEMLSSVAVINRALDSGDVST
VWKQLSNPVTGLTNVEDENSQRYIDDLMKLKAQMHAEENEFITWNDIQSCVDRVNLAVHE
EHERILAIGLINEALDEGDTKKTLQALQIPAAKLEGVTPKVAQHYQDTLLRAKREKAQDT
QDETAVLWLDEIQDGIQRANKDTEESQRFSLGILAINEAVDHGDTGCTLSALRSPDVGLY
GVTPECAETYQRELVEVKRRKMATGGNGSEWVKHWVRGGYHYYHNLRTKEGGWDEPTEFV
QNDTQLSREEIQSTISGVTAAYNREQLWLANENLIVKLQARCRGYLVRQEFNSRMSFLKK
QVPAITCIQSQWRGYKQRKAYQIRLDYLRAHKDQVVKIQSMTRMYQARRRYRDRLQYFRD
HINDVIKIQAFIRANKAREDYKTLINAENPPMAVVRKFVHLLDQSDQDFQEELELMKLRE
EVVTLIRSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMLNKQ
KGGLKALSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYAS
NQREEYLLLRLFQTALQEEIKSKVDQIHEIVTGNPTVIKMVVSFNRGARGQNALRQILAP
VVKEIIDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALNHEEVRTRLDAS
IRNMKTVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHDKFPDAGEDELLKIVGNLLYYR
YMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFMGDNAHLSIINEY
LSQSYQKFRRFFQVACEVPELQDKFNIDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQD
AIAPEHNDPIHELLDDLGEVPSIESLIGEGSGSINDPNREMLAKTEVSLTLTNKFDVPGD
ENAEMDARTILLNTKRLIVDVIRFQPGETLTEILDTPATSEQEAEHQRAMQKRAIRDAKT
PDKMKKSVSVKEDGNLNLQGKKEKIKTGLKKLTELGIVNAKNKYQELINDIAKDIRNQRR
YRQRRKAELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGK
NSKKISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMET
FMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences 9031.ENSGALP00000013987 ENSGALP00000013987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]