SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000015409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000015409
Domain Number 1 Region: 10-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 268-390
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-34
Family Spectrin repeat 0.000000549
Further Details:      
 
Domain Number 3 Region: 504-625
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-31
Family Spectrin repeat 0.00000345
Further Details:      
 
Domain Number 4 Region: 391-499
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-27
Family Spectrin repeat 0.00000285
Further Details:      
 
Domain Number 5 Region: 628-740
Classification Level Classification E-value
Superfamily Spectrin repeat 8.35e-23
Family Spectrin repeat 0.00000241
Further Details:      
 
Domain Number 6 Region: 733-865
Classification Level Classification E-value
Superfamily EF-hand 1.07e-21
Family EF-hand modules in multidomain proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000015409
Sequence length 893
Comment (Gallus gallus)
Sequence
MDHHYDPQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDF
RDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGN
VKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGF
CALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIM
TYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLEN
RAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGK
MVSDINNAWGGLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHESWTDGKEAMLQQ
KDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKI
CDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVH
TIEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQE
INGKWEHVRQLVPRRDQALMEEHARQQQNERLRKQFGAQANVIGPWIQTKMEEIGRISIE
MHGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQ
LLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLG
YDIGNDAQGEAEFARIMSIVDPNRMGVVTFQAFIDFMSRETADTDTADQVMASFKILAGD
KNYITVDELRRELPPDQAEYCIARMAPYNGRDAVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences P05094
XP_015142744.1.86415 XP_021259414.1.32913 ENSGALP00000015409 9031.ENSGALP00000015409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]