SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000021957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000021957
Domain Number 1 Region: 2-122,153-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-77
Family Calponin-homology domain, CH-domain 0.00003
Further Details:      
 
Domain Number 2 Region: 8395-8537
Classification Level Classification E-value
Superfamily Spectrin repeat 5.21e-20
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8045-8200
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-19
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 4 Region: 6964-7108
Classification Level Classification E-value
Superfamily Spectrin repeat 3.67e-19
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 7826-7950
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-19
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 3320-3442
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 7 Region: 7087-7222
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-18
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 7417-7548
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-17
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 9 Region: 1585-1743
Classification Level Classification E-value
Superfamily Spectrin repeat 3.67e-16
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 10 Region: 3104-3231
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000175
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 11 Region: 6753-6893
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000115
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 2444-2583
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 13 Region: 5079-5200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000216
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 14 Region: 4494-4651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000478
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 15 Region: 7340-7451
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000733
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 16 Region: 4276-4432
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000013
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 17 Region: 7954-8064
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000158
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 18 Region: 3748-3869
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000209
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 19 Region: 3901-4022
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000419
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 20 Region: 1715-1851
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000504
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 21 Region: 1388-1525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000564
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 22 Region: 2662-2791
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000071
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 23 Region: 3545-3686
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000202
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 24 Region: 7615-7764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000322
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 25 Region: 542-680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000116
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 26 Region: 8499-8647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000252
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 27 Region: 5700-5817
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000445
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 28 Region: 2232-2386
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000311
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 29 Region: 2338-2457
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000352
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 30 Region: 2035-2174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000054
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 31 Region: 5916-6056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000682
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 32 Region: 1054-1208
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000972
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 33 Region: 3014-3128
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000246
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 34 Region: 1918-2061
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000615
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 35 Region: 5507-5623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 36 Region: 2814-2931
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000228
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 37 Region: 3987-4121
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000843
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 38 Region: 4945-5043
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000187
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 39 Region: 6546-6631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000199
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 40 Region: 4606-4759
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000602
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 41 Region: 3466-3579
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000196
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 42 Region: 6677-6790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000302
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 43 Region: 6362-6471
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000489
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000021957
Domain Number - Region: 4193-4321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000348
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number - Region: 870-996
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000393
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 1289-1386
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000602
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 6066-6178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000648
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number - Region: 3234-3312
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000719
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 4816-4929
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000835
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 7219-7338
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0014
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 5613-5729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00187
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 5278-5368
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00202
Family Spectrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000021957
Sequence length 8787
Comment (Gallus gallus)
Sequence
LSDEQELVQKRTFTKWINTHLAKRNPPMMVSDLFEDIKDGVMLIALLEVLSGQKLPCEQG
RHLKRIHWVANIGTALKFLEGRRIKLVNINSTDIADGRPSIVLGLVWTIILYFQIEELTS
NLPQLQSLSSSASSVESVVSSETASPPSKRKVVTKVQGSARKALLKWIQYTAARQVGIEI
KDFGQSWRSGVAFHSIIHAIRPDLVDMEKVKGRSNRENLEEAFTLAETELGIPRLLDPED
VNVDKPDEKSIMTYVAQFLKYYPDPHHTVADVQENEEELQSIPTFVISFMKFKKEDKLML
RDLKVWAEQFERDLARAQVAETSLQEKYQSFKHFRIQYEMKRKPIELVTQSLRKDGKLSL
DQAIVKQAWDRVSSRLFDWHIHLDKSLPAPLGTIGAWLYRAENALREEVSIQQAHEETAN
IIHRKLEQLKDLLKNIEGHKKTFHEIHGARSVNGVPVPPDQLEDMAERFNFVVSSSELHL
LKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVELLLQNYISVIENSKFFEQYEVTY
QILKRAAEMYAKANGSVEEVESVMKFMSETTPQWRNLSVEVRSVRSMLEEVIANWDRYSS
TVAGLQAWLEDAEKMLNQTEQSKKDFFRHLPHWIQQHTAMNDAGNFLIETCDETISRDLK
QQLLLLNGRWRELFMQVKQYARADELDKIQKEYLDGVANLTAFVDGSNRKFSSAIEVSFL
DVKMFVQDLENIKQKLPTMEAQYKMVTRTAQLLTKEISQEEVNEMLATLTRMKEQLSKVK
EYSSALLYECQHLLSPLEEQEKQITNFYESLEKVNEIISIQDPEAQPTTVLKQKAQDLVA
YQENCKKALSLIERNSQSILQCVASSEVLQHFHQSTFQKKVTQVQITFQNMVRKAGDWRK
NIEANSRLMKKFEESRAELEKVIQIANCCLKEKGNPEELLRKHSEFFNQLDQRVLNAFLK
ACDELTDILPEQEQHSLQEAVRKLHRQWKDLQMEAPYHLIHLKIEVQKSKLLVTVEECKA
ELARQNKVLTREGKERMIEEHKLFFGDKGSYHLCGKRLQRIEELCHKLPVSDPVRATLES
SQRILKELKSQIDSTYTKLTEHSDIWKSYTNRFSELANWISSTERDLQRIKENVSDTAKY
EQFKSSTREIRQQINKQGENHSWLKSRLAVITKICTDVEAKKTEDELCKLSSDFKGLLDF
LAEIERTLGTVGDCVQYKEEVKSAIEELINNSKEAQAEAEKILDTESLLQAQQLLFHHQQ
RTRRLRAKRQGVQQQIFQAKQLQIEGGLPSAMQEDLLKLEGTLENMQQTMEKREEQLQVT
INKWEQFERDKETVVKYLNQASCALERILNFSSLESLSSELDQTKELSKHSEAMAVQAEN
LVKNSSEIQLGSKSKQALQQQAKAIQEQVKKVDVTLEEDLKRMEMMKNKWDHFGKNFEAL
STWIAEKEKELETLETASSPLDIQISQIQVINTEIDGKINGISKLEEEAKSFTQFVTSGE
CAHIKAKLTHIKRYWEELREHAQRLEGTITGKASAQQKYEESLKQVQKTVSEFEAKLAEP
LTSCTSSSATYGDLQDCTDFCHTVEKLSSTLASLSACARKAASKEKAAQEVTALQQRYEK
VLENAKEKQILLETLLARWQKQEKELCAFQTWLEGCEAAGRPSEQYVSADRVKLEGELQS
LQDLRADFESHASIYASLLQLNELLFPTASKQCVKAINEKFKELDERWKALPQTIDKRIN
FLQSLVAKHGQFDELLCSFSDWIKQFLAELQSTSEINTADPEVAASHNKKHSVEIESKKQ
QLQSLKDLVDKLCAFSCPVDQQTLQGKTEDCFQIFQEANQITNQRQEALDQLQVFLELHN
AASRVLHQLRQTVEKTGNIDKAKSELLEKDLHDVIQSLNKLEAIAISLDGSLTKAQYHLK
HGISEQRTSCRAVVDHLYLELEAVQNLLGTKQSEAEALATLRRSFMERKEELLKSIEDTE
EKADKEGLREATLQALQQRLRIFNQLDEELNSHQHELQWLMDKAKQIAQKDITLAPEIDK
EINHLASLWEDTKKVIQEKKEQSCILIDLIKEYQGLKSTVMKVIDSVDSASVLKSIWKDH
EDIRRTLSKHEAAKNDLSDKQKDLDTFTNKGKHLLAELKKVQNCDCTVVKTDMNSTVDKW
LDVSERIDDNIHRLSSGVSLWDDILKIADEMDGWCTKCISHLNEGISNLSNSQRMEVILK
DFQSQVKDKEQKLEQLSSKISELKELTHSQEPPADLQFIESDLRQKLEHAKEMSQTAKET
LKEFSTQKMQLQKFIDKMTHWLTETEETLLRCSRNLDPESLNLVKETQKDLQLQQSSIDS
TRENLNRLCRKYHSVELETLGGTVTSLIKKYEAVNQLCSRTQANMQECLEKHFLYSMQEF
QEWFSDVKAAVKELSDRSGDSKAIEAKLHDLQSVLDSLSEGQNKLDAACKEGENLYTCLP
QPVVTHIQEQVTKSNQNFKEFLSQCLNDKQALETCASHLGSFEEQHKKLSLWIHDMEERM
STEALGEIKELIPEKKKEVQKVEKFLEELLASRESCEKLAQIAQALNEEGHGAGREVRLA
SQHLTNYQNMVKTVKEKLRTCQLALQEHLTLEEALQSMWSWVKEVQEKLASAESTVGSKA
MLERRLAQIQEILLLKGDGEVKLNMAIGKGEQALRSSSEEGQKVIQTELQKLKDVWNDII
STSMSWQSVSCLESLISQWNEYLERKSQLEQWLEKLDHKVEQPLEPQIGLKEKFAQLDFF
QAIVSEIEDHSGDLQQLVEKTAELYEKTEDDSFGAAAQEELKTQFNDITTVAKEKMKKVE
DIVKDHLLYLDAVHEFTDWLHSAKEELHRWSDATGDTSVIQKKLAKINELVDSRQIGAGR
LGRVETLAPAAKRSTSAGGCQLLAAEMQALQLDWKQWEESAFQSQRSLRDVLSQMAVSEQ
EFAAQVARLEEAVQRFGGLLADWSQSLAPLDSRHTDAEIVESWRKEKETSDALIKSEHVI
DEIKTQLNDLCRFSRDLSTHSSKVSGLIKEYNSLCLQASKGCQSKEQILQQRFRTSFRDF
QQWLVNAKVTTAKCFDVPQDISEASASLQKIQEFLSESENGQHKLNLIASKGELLCSVLP
KEKAKVISDKCAMAKEDWKNFISTLHQKESALENLKIQMKDFEATAEPLTEWLSTTEKIV
QGSSSRLHDLSSKRREQQKLQSVLEEISCHEHQLNRLKEKAQQLLEEQAVSKSFMRRVSQ
LSSQYLTLSNLTKEKVSKMDRVLAEHQQFSHGFKDLQDWVADAIHMLESYCHPTADKNVL
DSRMLKLEGLLTVKQEKEIQMKIIMTRGESVLQNTSLEGAQVIEQQLHTLKDSWASLLSA
CIQCKSQLEGALSKWTSYQDDVRQFTSWMDKVEASMHSSERQYAELREKTAALSKAKLLS
EEVLSHSSLLETIEAKGSGMAEHYVTQLELQELQDRYKLLKDRTREAVKKAEELLNLHQG
YQRNLKAFETWLEEEQEKLSCLSHLEGDAQKQEATLRDLQELQVRCAEGQALLNAAVRAR
EEVIPWGMPQIEDRVLESIRQDWQVYQHNLSEARSQLNATVSRLRLMEKKFQKVNDWITE
LEEKVAVRTGRQSGRATKEMQLQQMKKWHEEITIYKDDVEEVGILAQQILEEGLTTSGMG
SQATQLTSRYQTLLLRILEQTKFLEEEIRSMEESELAFSAYKNWYGATNKDFRNVITKFD
VLDKTAMEKKVQKLELLLSDMDIGHSLLKSAREKGERAIKYMEENDADCLRKEIGEHVEQ
LEDLAGSIRKEHVTSEKCLQLAKEFSDKYRAQTQWLTEYQAMLRTPVEPKCELYEKKAQL
SKYKSMQQTILSHEPSVKSVIEKGEALFDLVNDVTLKSNIQDLQSDYHELCSAAKAYVET
LEVRVKEHEDYNSDLQEGEKWLLHMSSRLVSPDLMENNSLEVITQQLANHKAIMEEIAGF
EDCLNKLKSKGDYLINQCTEHLQAKFKQNIQSHLQGTRDSYSAICSTAQRVYQSLEHELQ
KHVNHQDTLQQCQTWLTTVQSELKPSTWTPFSLADAVKQVKHFRALQEQANTYLDLLCSM
CDLSDATVKSTATDIQQTKQMIEQQIMHSQYLAQGWEEIKQMKAELWIYFQDADQQLQNL
KRRRAELELNIAQNMVLQVKEFSQKLQSKQSALTSVTEKINKLTQGQESPEHKEIGQLSN
QWLDLCLQAHSLLIQREEDLQRTVDYHDRMNVVELFLEKLTKEWDNLARSDAESTNVHLE
ALEKLALTLQERRFALEDLKDQKQKMVEHLNLDDKELVKEQFGHFEQRWTQLEELVKRKM
QISVSTLEEFSLVHSKLQELMEWAEEQQPSISEALKHSPPPDLAQSLLMDHLTICSELEA
KQLVLKTLLKDAERVMTSLGLNERQELQKALSDAQHHVDCLSDLVGQRRKHLNKALSEKT
QFLLAIFQATNQIHQHEKKVTFPEHICLLPEDVNKQIRTCKNAQASLKAYQNEVTGLWTQ
GRDLMKEATEQEKSEVLGKLQELQNIYDTVLQKCTQRLLELEKNIVSRKYFKEDLDKACH
WLKQADIVTFPEVNVMNSNSELYTQLSKYQQILEQSPEYENLLLALQRHGQEILPSLNEV
DHSYLDEKLNILPQQFNIVTALAKDKFYKVQEAIYARKEYTSLIELTTKALTELDDQFIN
MDKAPASVLAKEVVSLQQAYRDLLGEVMSLGAAVDELNQKKEAFRSTGQPWQPDEMLKLA
TLYHKLKRQIEQKISLLEDTVEACQEHEKMCTQLEAQLEAVKNEQIKVNEEMLPIEEKLK
IYHSLVGSLQDSGSLLKRITEHIETLSPQLDPSALETTNHQVLSWQDKLKNLHSAIGDIV
MDCENRLVQSIDFQTEICRSLDWLRWVKTELNGKLSLDLKLQSIQEEIRKVQIHQEEVQS
SLRVMNALSNKEKERYMKAKELIPADLENTLAELAELDSEVQEAIHMRQATLDKLYSLCQ
RYYQVIQITNDWLEDAQEFLHLTRNGLDVENSEGNLGNHIEFFSTESQFSNNLKELQGLV
SELEPFILATAREQLMQNLASLEEKGKGTKQEAKTQQELLQRCASEWQEYQTARQKVIEV
MNEAEKKLSEFSVAKAASSHEAEEKLQTHKTLVSVVNSFHEKITTLEEKASQLEKVSNDA
SKATVNRSVTTVWQRWTRLRNVAQEQEKILEDAVQEWKGFNDKIQKATVVIDQLQDRLPE
SSVEKASKTELLELLDYHSSFLLEVEHQLSSLGLLKQHALNMLQDVEIKPLSQEEVPVMQ
EVKAMQDRCHNMQQKVKKSVKLVKQELKEREDVEAQINVVKTWIQETKEYLLNPDVEVDT
QLQELKSLLSEVTTHRQAVEKMAEQQQNKYLGLYTILPSELSLHLAEVGLALVTVQDQIQ
AKEKETEHIKTLNQEFGQRIQGIANELNAILSKLKRKTNDIVQAKFEQKILGEELDSCNI
KLLELDASVQEFSEQNIPLAKQLANRIGKLTALHQQTIRQAEYRATKLSQATSHLEEYNE
MLEFILKWIEKANILVHGSITWNSSSHLRDQFKAYQTMLEESAEIHGDLEAMSERIEYLA
SVYSTEGMSQQVLELGRRTEELQQVIKVRLPNLQDAAKDMKKFEVELRALQTALEQAQAT
LTSPELGRLSLKEQLSHRQHLLSEMESLKPKVHAVQVCQSALRIPEEVVTSLPICHSALQ
LQEEASRLQHTAIQQCNIMQEAVVQYEQYEQEMKHLQQMIESAHREIQDKPIATSNIQEL
QNQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLSEGMEELDSD
LLPAHPAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTDASVNQ
DIAYYQALSAEQLQTEAAKIQPSTSATQEFYEPGLESAASAKLDDLQRSWETLKNVISEK
QRTLYEALERQQKYQDTLQSISTKMETTEMKLNESLEPAKSPESQMAEHQALMDEILMLQ
EEITELQTSLAEELVSESLDAEAADQLALQSTLTVLAERMATIRMKASGKRQLLEEKLSE
QLEEQRQEQALQRYRCEADELDHWLLNTRATLDTALVTAEEPMDMEAQLVDCQNMLVEIE
QKVVALSELSVHNENLLMEGKAHTKDEAEQLALKLRTLKGSLLELQKVLHDKQINIQQGS
LQEKEESNLDLVSSQSPSVQEWLAQARTTRSQQQQSTLQQQKELEQELEEQKNLLRSVAC
RGEEILTQQGIPEGLFQALNEKPEKLSEELCLEGEKSSPEQQLKIKWESLNHKFNTKQKL
LQKTLEQEQLQLYSRPNRLISGLPLYKENGQDEEKSSVSPVLVELNQAFEDVSSEAGRVE
KESLHLEQKLYNGVASTSLWLDGVEEQVFVATALLPEEETETYLCKQEHQSLAKEIKDIT
EEMDKNKNLFTQIFPENGDNREVIEDTLDCLLRRLTLLESVVNQRSHQMKERLQEIMTFK
NDLKLLFTSLADSKYLVLQKLAEAAEKPETEQIQVIMQAEESLKELDAGINELKKSVDKL
QIDQPSAQELSKLQDMYDEVMMIIGSRRSDLNQNLALKRQYERALQDLADLVETGQEKMD
GDQKMIVASKEEVQSLLDKHKEYFQGLESHMILTETLFRKMSSFALLKETQSHSELIAQA
STVLKLAHKRGVELEYILETWMHLDEAYQELTRQLESVEGNIPAVGLVEETEDKLTERIK
LFQHLRSNLTEYQPKLYQVLDDGKRLLFSVSCSDLESQLNQLGEHWLSNTSKVNKELHRL
ETILKHWTRYQSESTELTHWLQSAKERLEFWSQQSLTVPQELETVRDHLSSFLEFSKEVD
AKSSQKSSVLSTGNQLLRLKKVDTAALRAGLSQIDSQWTELLTQIPAVQEKLHQLQMDKI
PSRHAITEVMSWISLMENVIHKDEESIKNVIGQKAIQDYVQKYKGFKIDLNCKQLTVDFV
NQSVLQISSQDVESKRSDKTDFAEQLGAMNRRWQILQGLVTEKIQLLESLQESWTEYENN
VQCLKSWFETQEKKLKKQQRIGDQASVQNALKDCQELEESIRTKEKELESIEQSGLSLIQ
NKKEEACSAVLNTLQEINHSWANLDHMVSQLKILLQSVLDQWSIYKVTYEELNSYLMEAR
YSLSRFYLLTGSLEAVKVQVDNLQSLQDELEKQENSLQKFGSVTNQLLKECHPPVTETLT
STLKEVNMRWNNLMQEIAERLRSSKGLLQLWQRYKDCYQQCSSTVRLREDQTNELLKTAT
SKDIADDEVTTWIQDCNDLLADIKTAQDSLIVLQELGEELKSRVEASAAAAIQSDQLSLN
QNLSALEQALCKQQTVLQAGVLDYQTFAKNLQDLEAWITEAEAKLKGQDPGHTSDLSAIQ
SRMEELKSQMLKFSSMAPDLEHLNELGYRLPLNDKEIKRIQNLNRQWSLISSQTTERFSK
LQSFLLQQQTFLEKCETWMDLLVQTEQKLAAEISGNYQSLLEQQRAHELFQAEMFSRQQI
LHSIISDGQHLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIHQWQRYRE
MAEKLRKWLMETSCQPVSGLGNAPIPLQQVRALLDEVQLKEKVLLRQQGSYILAVEAGKQ
LLLSADSGAEAALQAELTEIQERWKKVSNQLEEQKKQVALLLKDWERSEKGIADSLEKLR
SFKKKLSQPLPEHHDELNAEQIRCKELENAVDGWTDDLAHLSLLKESLSTYISADDISVL
NERIELLHRQWEELCHQVSLRRQQVSEKLNEWAVFSEKNKELCEWLTQMESKVSQNGDIV
IEEMIEKLRKDYQEEIAVAQENKIQLQLMGERLAKASHESKASEIEYKLGKINDRWQHLL
DLIAARVKKLKETLVAVQQLDKNMSSLRSWLAHIESELSKPIVYETCDSEEIQRKLNEQQ
ELQRDIEKHSTGVASVLNLCEVLLHDCDACATETECDSIQQATRNLDRRWRNICAMSMER
RLKIEETWRLWQKFLDDYSRFEDWLKNSERIAAFPSSSGVLYTVAKEELKKFEAFQRQVH
ESLTQLELINKQYRRLARENRTDSDCSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQR
EEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNNNKIQQIIVQG
EQLIEKSEPMDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLTDDEHELSDREVDLD
ESADLSDIHWHDKSADSVLSPHPSSNLSLPLAQPVRSERSGRDTPASVDSIPLEWDHDYD
LSRDLETAVSRALHSEEEDGEQEKDFYLRGAASIAGEPGSLEAHIRQLDKALDTSRFQIQ
QTENIIRSKTPTGPELDATYKGYMKLLGECSGSIDSVKRLGYKLKEEEEKLSGLINLNST
ETQTAGVIDRWELIQAQALSKELRMKQNLQQWQQFNSDLNSIWAWLGETEEELEKLRRLD
LSTDIQTIELRIRKLKELQKAIDNRKAIILSINLCSSEFTQSDSEESKKLQERLSQMNIR
WDHVCSMIEEWRCSLQDALMQCQDFHEMSHGLLLWLENIDRRKNEIVPINPNLDSEILQD
HHRLLMQIRRELLESQLKVASLQDMSCQLLVNAEGKDCLEAKEKVHVIGNRLKLLLKEVI
RHIKDLEKALDISSSQLDLSSWSSADELDTSGSVSPVSGQSTPSRQRTPRGKCSLSQPGP
SVSSPHSRSIRGGSGSSPSEAGPAWQHPSFFLRVLRAALPLQLFLLLLIGLACLVPMTEE
DYSCAMANNFARSFHPMLKYMNGPPPL
Download sequence
Identical sequences 9031.ENSGALP00000021957 ENSGALP00000021957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]