SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000023016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000023016
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000187
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000023016
Sequence length 1010
Comment (Gallus gallus)
Sequence
DNIILFLRGCKELGLKESQLFDPGDLQDTSNRVTVKNVDCSRKLKNVLVTIYWLGKAANS
CTSYSGSTLNLKEFEGLLAQMRKETEDIESPKRSIRDSGYIDCWDSERSDSLSPPRHGRD
DSFDSLDSFGSRSQQTPSPDVVLRGSSDGRGSDSETDLPHRKMPDVKKDDMLARRTSHGE
PKSAVPFNQYLPNKSNQTFYVPAPLRKKKAEREEYRKSWSTATSPLGDRPFRFGPRTAVS
DDAESVSMFDMRSEEEAMAQPHSKARHEKLQNIHNQLKEDETRWQDDLARWKSRRRSASQ
DLIKKEAERKKMERLLSGEGTNERRKSIKTYREIVEEKERRERELHEAYKNAKTQEEAES
ILQQYIERFTISEAVLERLQMPKILERSHSVEPNSPLKDPNPLRYLRQQSLPAPKFTATI
EATIVPTTELEPSGSTGRTSPSKSVVSKAVPMLTPKPYSQPKNTQEVLKNFKVDGKVSMN
GENFNGVEEKDKECTTVIFTQSPSRSLKFDGVARGDGPPIELKKDPTSVELSLQRPATQS
VHREPTAHQPQTKTSSQEEKLDVGKQKKGDLKCVCSEQKQFKSTVLCASPVVKSLEFSPS
PVPPEETAPSEKDVKKPEMEKQKEAALPAMQEVMKPKALEQEGSVVLPFLKKLPETSQVT
LHNSDLQADSGNSDKSNLAFPSHQRFNFWSWDPEEERKRQERWQHEQERLLQEKYQKEQD
KLKEEWEKAQREVEEEERRYYEEERKIIEDTVVPFIVSSNSAELLSSSSSTTEGNKTANT
SDSNGSPEEGKPKEVTRQKKLVWEQDSIASLKNKENERWQEKRSGNKVLSGHPEVGILKG
GDQEYQVPVMERCSPARLNLPLTQDVPWNQQLLTKQSPHHAEDARQRPLLGQSAGQQPSA
AGEGRRAGCHENFRSGPSSPCSPAAPSQSPNRSVSGKKLCSTCGLPLGKGAAMIIETLGL
YFHIQCFRCGICKGQLGDAASGTDVRIRNGLLNCNDCYIRSRTAGQPTTL
Download sequence
Identical sequences 9031.ENSGALP00000023016 ENSGALP00000023016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]