SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000024507 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000024507
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.64e-50
Family Calponin-homology domain, CH-domain 0.000000537
Further Details:      
 
Domain Number 2 Region: 204-263
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 6.54e-19
Family EB1 dimerisation domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000024507
Sequence length 297
Comment (Gallus gallus)
Sequence
SWGMAVNVYSTSITQETMSRHDIIAWVNDILALNYTKVEQLCSGAAYCQFMDMLFPGCIS
LKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFFDA
NYDGKEYDPVEARQGQDALPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSR
PSSAKKAAPSSSASKSDKDLETQVIQLSEQVHSLKLALEGVEKERDFYFGKLREIELLCQ
EHGGENNDLVHRLMEVLYASEEHESHTEEHEGEEQVHEQPSRRSTDSRSVSDNFHFV
Download sequence
Identical sequences ENSGALP00000035995 9031.ENSGALP00000024507 ENSGALP00000035995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]