SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000024768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000024768
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.97e-46
Family Calponin-homology domain, CH-domain 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000024768
Sequence length 199
Comment (Gallus gallus)
Sequence
MANRGPSYGLSREVQEKIEQKYDPELESRLANWIIVQCEEQIEPPPPGRQHFQTWLMDGT
LLCKLINSLHPKGNEPIAKISESKMAFKQMEQISQFLKAAEIYGVRTTDIFQTVDLWEGK
DMAAVQRTLMALGSLAVTKDDGCYKGDPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGS
NKGASQSGMTGYGMPRQII
Download sequence
Identical sequences A0A226ND87 A0A226NVM7 E1C7W7
XP_003202846.1.16129 XP_015153171.1.86415 XP_015733783.1.68032 XP_021256835.1.32913 XP_416634.1.86415 ENSGALP00000024768 9031.ENSGALP00000024768 ENSGALP00000024768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]