SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000026214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000026214
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-74
Family Calponin-homology domain, CH-domain 0.00000445
Further Details:      
 
Domain Number 2 Region: 1700-1882
Classification Level Classification E-value
Superfamily Plakin repeat 4.58e-44
Family Plakin repeat 0.00078
Further Details:      
 
Domain Number 3 Region: 1489-1694
Classification Level Classification E-value
Superfamily Plakin repeat 7.32e-41
Family Plakin repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 218-334
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 6247-6363
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 6 Region: 6421-6581
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-26
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 7 Region: 5762-5921
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-25
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 8 Region: 6664-6797
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-25
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 9 Region: 5220-5376
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-25
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 6003-6141
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-22
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 11 Region: 4781-4936
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 5655-5807
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 6794-6909
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-20
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 14 Region: 3983-4130
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-20
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 7129-7208
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-20
Family GAS2 domain 0.00059
Further Details:      
 
Domain Number 16 Region: 4449-4578
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-19
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 17 Region: 6578-6698
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-19
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 18 Region: 5372-5487
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-18
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 19 Region: 1195-1320,1347-1371
Classification Level Classification E-value
Superfamily Spectrin repeat 7.28e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 20 Region: 6109-6241
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-17
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 21 Region: 4994-5156
Classification Level Classification E-value
Superfamily Spectrin repeat 4.47e-17
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 22 Region: 652-754
Classification Level Classification E-value
Superfamily Spectrin repeat 5.18e-16
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 23 Region: 5441-5587
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-16
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 24 Region: 7040-7120
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000169
Family Polcalcin 0.044
Further Details:      
 
Domain Number 25 Region: 4671-4794
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000036
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 26 Region: 3747-3869
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000025
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 27 Region: 5918-6032
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000301
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 28 Region: 4359-4465
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000198
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 29 Region: 4577-4683
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000761
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number 30 Region: 3891-3997
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000106
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 31 Region: 559-650
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000851
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 32 Region: 732-834,955-974
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000245
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 33 Region: 4200-4322
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000748
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 34 Region: 6919-6979
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000124
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 35 Region: 3211-3355
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000128
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 36 Region: 4105-4210
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000995
Family Spectrin repeat 0.0074
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000026214
Domain Number - Region: 3381-3501
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000161
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 971-1123
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000222
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 3512-3625
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0015
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number - Region: 5602-5674
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0132
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000026214
Sequence length 7423
Comment (Gallus gallus)
Sequence
VQVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKKRQVK
LVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWSQQTTEGYA
GIRCENFTTCWRDGRLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFFVAEKLGVARLLD
PEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGISANDVEVKWVEYQNMVNYLMQWIRH
HVTIMSDRTFPNNPVELKALYNQYLQFKETDIPPKETDKLKIKRLYKLLEVWIEFGRIKL
PQGYHPNDIEKEWGKLIIAMLEREKTLRPEVERLEMLQQIASRIQRDSRSCEDKLILARN
ALQADTKRLESGLQFQHEAEIAGYLLESENLLRQQVIDAQILIDGKYYQADQLVQRVAKL
RDELMAIRTECSSLYSKGHALTTEQTKLMISGITESLNSGFTTNLTPDLNAAMTQGLTPS
LTSSSLTSGLSSGLTSRLTPAMTPAYTPGIPPRLIQSYVTGVDGGTLQTLKLMQIRKPLM
KSAFVDQNLTEEEVNMKFVQDLLNWVEEMQVQLDRVEWGSDLPSVESHLENHKNVHRAIE
EFESSLKEAKISEIQMTAPLKLSYAEKLHKLESQYSKLLNTSRNQERHLDTLHDFVSRAT
RELIWLNEKEEEEVAYDWSERNPNITRKKEYHAELMRELDQKEEVIKSVQEIAEQLLLEN
HPARLTIEAYRAAMQTQWSWILQLCHCVEQHLRENASYFEFFSDAKEAMEYLKNLKDAIY
RKYSCDRSSSLHRLEDLVQESMEEKEQLLQYKSTVAGLVGRAKAIIQLKPRNPDCILKTS
IPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPSGNEAMVPSVCFTVPPPNKEAI
DTANRIEQQFQNVLALWHESHVNMKSVVSWHYLTNEIEAVRAGNVASIKTMLPGEHQQVL
SNLQSRFDDFVEDSQESKIFTSSDTAQLEREVSICKQYYQELLKSAERAEEHEESIYNLY
ISEVRNIRLRLESCEERLIRQIRTPMERDDLHESVFRISEQEKLKKELDRLKDDLGVITD
KCEEFFSQAAGSPSVPTLRSELSVVIQNMNQVYSMSSIYIDKLKTVNLVLKNTQGAESLV
KLYETKLCEEEAVTADKTNIENLMGTLKQWRSEVDEKREVFHALEDELQKAKMISDQMFK
THKERDLDFDWHKEKVDQLAERWQNIHSQIENRLRDLEGINKSLKYYKDTYDSLDTWIQQ
VEDTQRKIQEIRPENSKALAKQLNQHKMLVSEIEMKQSKIDECQKYAEQYSAAVKDYELQ
TMTYRAMVDSQQKSPVKRRRMQSSSDFIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRL
EEEERSMEEEKKEHVEKAGDLLKWVSNLSKTLSKEGGEKAEKTDLPKQQISLEEMSAKKE
QIAEALQTTQAFLAKHSDKMTDEERGEMEKQVKSLQESYSLLSHEALKQLQEAQYLDDEK
MEEKVHKVIAGIIDQTTGEVHSIFQSILKGFIDYDTGVRLLENQLVLTGIISPELGICYD
LEEAKACALVDEQTVLQLQELNSAKKLISESTLSNLPVVSALEQGLISEPLAIKILEIQL
SSGHLILPSTGEHLTLQNAFQRNLISPTLYAKLLERQDTCKDLIDPNCAEKISLEQMLHR
SIIHDKTGLRLLSVKPQEKGRIILKCGRKITILRAAHEGLIDRETMFRLLGAQIISGGII
DPESGKRMTVEEAVSQGIIGQDTACGIFTHQVQTGGILCPNSGQRLTVDEAIQCNLISST
SALLVLEAQRGFVGLIWPDTGEIFPISTSLHQEMITNELAFKILSDRQKIAALYIPETCE
VLSLDRAAQSGLIDINTVSVLNSVTLPDKMPNVEELESPCKNAAKWLSSYEVLTSLFHDC
EEDREDSGTEDPACHNSDQAKKLFISYLMVNSYMDANTGGRLLLYDGQLQEAISMFLEGD
SSAYGSDVSEMAFSNKYINLKGINLKSAGNVHLSNITGSAQGGPSGAEITSDDKKLIQFE
DLGNYTCSQRKDICRSDVCSDSGTEQSQFTLEMLLSKPAELKNVEINTQNFENRNTLEGL
LEDSEWTPLEVYGHNDQKANSGNTEGVFPNDSNPNLMSGRENSLSVNDLSDNEIWGDLEK
TCMKYEPHVLQADSYRMALSNVEKDTEYRIPEESDSKCGDTLQFEGNEYSEQPLLDYTDV
HNRPSLESCPYSHGRQSLDSSTDFQSKLCLEDSREIQWRPLLEANTGTHDGPPEGVSNST
AQSLPVEENNLVFDKLLPGDSSSDSSLEGSDSIPQFESSCSQHECGEADSEEDSSQFDDD
DDAYETPQVDDDDSDVYGTPQFDDNDSYDTPQDDADFGTLQLEDDDTPEPENVPLGFLEE
RGGLIALKGENSSYEELPTNAGENVHYIRDINQTALTEGVNVASASEETLETVSEEERER
TRDFEEEQKLTVTLGSEERREGCSTSLLKRYVTKTQQDRNEEDEMKAESDCYEYESEGTQ
EEEDYDYDYLDYDSYDDSDTESDSEEEMDTFYSHHQCENKDDQMLNSAGNIENSEENNQN
IDDYCYSLGHKTEYNLQFLANRGNGELSLGKCETASDICEERCVDLTCTGKKEREQNPEN
DYETFTKRENMSEDTTEHIESENTFDIKCISCKSEENNKTHFLDDTVVSDVSATPFLNAK
QATGDDENAQTDLLLSEHFIHSMNKSCSTMPMLQLDHGQRQKEAVFVEEKTLNDVTGLEQ
LKASSSQKDSKFLTDMHYASDDVSSLCDQLHPVTDKKHGQIRRDCEVLAENEVNITKEFG
VMELNKSPIHMESLGEIFDASTIKADTETVSNNEKVNIGQTWPDVGSGVRSAEFKRDFNL
SSSLEQCKTSLKGENNSELVKPKEISMTKETFICQSADNVLKDISENKNSNDDEFTLIKA
GALGSTEDAKESGIEIEVLPSGNHTRTTDLSSAILSSIEADWNNVAQKESEAVKNTKGEK
FMASETSSFENGFKKQLCMESLQNDMGPSKAFQVTEGFSQSPEMPDTLMEDLKNILQRKL
KLGHTYSKQEGEPLSYSDTKILMQNLLRMVGSTELGSSMSSESQLKQTSSTVTEALMDTT
LCTDTKSPDLLRDILKQEFCNQKMNDPDEMKSEIEQEVKTPTANLTASELLKIFKMSSGD
ESKRKLEELISSLLTSSQGAGITTAREGKGTVDELCALFSTELPKEKTLADDTADAWKSL
TGSAYTTKALLDDSSTSMVDGEQGCLKLREKMQEHLAVLQEVKRHLENQKPISSNLEILK
EQLEQLESFESGLATFAIILKKDMKLTEEFLKFHHKDIPEEKLKELKISYDYLQEAFLMV
CDTSSKRAKQIVCSVDLEMSKLAELHQQLLSKLQTFSDWITGHNKIINDFKVNTDDIEDM
KQSLKLLKNTAAEVARTKMQLESTAFDVQFFISEHAQDLSPNQSKQLLRLLNTIQKSFQE
VQETVTSQVESLETQLQAAQELGDQKDVAERQQECKEKLQEICDMLTQTENRLIGQQESL
LIGDSKAELEQYQTKQEEIQKDMRASAQTLAEIVKNTENFLKENGGKLSQEDKAVLEQKL
NEAKTKCLLLSQKAEESKKELDKAMTTAIKQETEKVAAIEQLEESKNTIENLLDWLSNVD
KEAEHGRKFKQAIEQNGTHFEEGDVKALEGEEDDVNGNLLEIQQDIETQVDGLVKSTEDN
LNQQYQKVKAQHEKIISQQQAVIIATQSAQALLEKQGHYLSPEEKEKMQRNMKELKAQYE
TALAESERKMKMTHSLREELEKFDTDYNEFETWLQQAEQELDNLEAGASDFSGIMVKLKR
QKSFSEDVISHKGDLRYITISGQRVLDAARSCSKRDGVKVDKDGIDTSATYTEVQNKLDS
ASDRFKSLYTKCSILGNNLKDLADKYQHYEDASSGLLSGLQASEVAVNKQLSEPIAVDPK
NLQRQLEETKVLQGQVSNHQIAVEKLKKAAEVLLDSRGELASDKEEIQKTLDDIVERYDN
LSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMEGVEKSLEEQDQVPLNSAAIQDIISKS
IMLEQDIAGRQSSINTMNEKVKKFMETADPSTASSLQAKMSELAGRFSAASKKHKEKLMK
MEELKTKVELFEGLSEKLQSFLDEKNQALSETEAPRKDVSEVSQYMQEASVELAKHKKDL
EVLQNLLEELSLHALPGDKALVLEKVNALSKKFREVEETVKEKEEDVSSCQKEIDSFELL
VESLKKWIKETTERIPAAQPSLNTEELKKPLEDTLNLKDEWTLKATELQKMNSRGTLLCS
LISAVTSPAKLRAVAKSGGTVLNGEGGAPGTQDFLKNKELTSVQQAMSDVNHSYEDLGVS
LKKKISELESMLSKMQNIQEESTSMMQWLQKMDKTASDWEAAPTDSEAVKAQVEQHKLFE
TELKQSENKVQELKDKVTELLEKNPNSPEAPKWRQVLDKIDSKWKELNQVTSERQQKLEE
SSNYLTQFQTAEAQLKHWLVEKELMVSVLGPLSIDPNMLNTQKQQVQILLKEFDTRKPQY
EQLTVAGEGILKRPGEHPPSHEIVKEQLAAVAQKWDNLTSQLSNRCDRIDQAIVKSTEYQ
SLLRSLSDKLSALDSKLSSSLAVSTQPDAVKQQLEIAKEMKKEIEQEMKNINAAQVLCEE
LSTLVGEEYLKAELTRQLDGILKSFKDIEQKSDNHVQQLQSAYTTSHQFQQTSKDFQAWL
DGKKEELKQARPISAKLETLQSLIEEQKDFMKTLTNEISSYEKIVAEGESILQKTQGADK
AALQDQIATLRSNWDEMDKEVKERQGKLADCLEKALKYKQHVESLQPWIEKCQSNLSELK
VGINPVEIENSVVQVRAWQKDLDKHHGIVELLNNTAESLLSASQTDKEIVKEETKVLNEK
VSMVTEQLHKKRECLENMAQRLKEFQESSRETEKQLQSAKEHLEAHDSLGPQSFSNKHLT
MMQAQQKALQALRPQVDLVKKLAQDLVVEASDSAGVSDLLLQAESLEQEYTAVNQQVEDR
CSFLETKLQGIGHFQNSIREMFSQFAEFDDELDSMAPVGRDLDVLQSQREDIKHFLKKLE
DLIMNNENANKNCKMMLATEAEASPDLVGIKRDLEALNKQCNKLLDRAKAREDQVEGTIN
RVEEFYSKLKEFSSLLGRAEEHEESQGPVGMETETINQQLNTFKVFQKEEIEPLQVKQQE
VNWLGQGLIQSAAKSTNTESLEHDLEDVNTRWKTLNKKVAQRAAQLQEALLHCGRFQDAL
ESLLSWLIDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKPTVEVIKREGEKIAE
SAEPADKVKILKQLSLLDSRWDALLSKAETRNRQLEGISVVAQQFHEALEPLVEWLSATE
KRLANAEPIGTQASKLQQQISQHKALEDDVLAHNKSLLQAISIGQSLKTMSSREDKDMVQ
EKLDSSQARYIEIQEKSNSRSELLQQAYCNAQIFGEDEVELMNWLNEVHDKLSKLSVQDC
NTELLEKQHSELLELQEEILLRKQNVDLAIQNGLELLKQTTGDEVIIIQDKLEGIKVRYK
DITKLSSDVSKTLEQALQLAGQLHSTHEELCKWLDKVEVELLSYETQMPKGEELSQAQER
QKELKQEAKNNKALLDTLNEVGSAFLELVPWRAREGLDKMITEDNERYRLVNDTISQKVD
EIDAAILRSQQFDQAADAELAWIAEAEKKLMSLGDIRLEQDQTAAQLQVQKAFTMEILRH
KDTIDELVKSGDKIMNTCTEEEKQTIKKKLKSLLQKYDTVCQMNSERNLQLERAQSLVNQ
FWETYEELWPWLTETEMIISQLPAPALEYETLKQQQEEHRQLRELIAEHKPHIDKMNKTG
PQLLELSPGEGFSIQEKYVAADTLYSKIKEDVKKRALALDEALSQCTQFHDKIDPTLESL
QRIVERLRQPPSISAEVEKIKEQISENKNVSMDLEKLQPVYETLKQRGEEMIARSEGADK
DVSAKVVQDKLDQMVLIWQDIQTLTEEREAKLLDVMELAEKFWCDHMALVATIKDTQDFI
RELEGPGVDPSVVKQQQEAAEAAKEEIDGLQEELESVVSLGSELRAACGEPDKPIVNKSI
DELNSAWDALNKTWKERVDKLAEAMQAAVQYQDGLQAIFDWVDIAGIKLASMSPVGTDLE
TVKQQTEELKQFKTEAYQQQIEMERLNHQAELLLKKVTQESDKHTVQDPLSELRIMWDSL
EEKIINRQHKLEGALLALGQFQHALDELLTWLTHTEDLLNEQKPVGGDPKAIEIELAKHH
VLQNDVLAHQSTVEAVKKAGSDLIESSAVEEASNLRSKLELLNQRWQNVLEKTEQRKQQL
DSALIQAQGFHGEVEDMQQWLTDTERQLLASKPVGGLPETAREQLNTHMELCAAFEAKEE
TYKCLMQKGQQMLARCPESAETNVEQDINNLKEKWESVQTKLGERKTKLEEALNLAMEFH
NSLQDFINWLTQAEQTLTAASRPSLILDTVLFQIDEHKKVFATEVNSHRDQIIELDKTGT
HLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRALDDARKRAKQFHEAWHKLMEWL
EESEKSLDSDLEIANDPDKIKMQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTTLADD
NLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYKIEPQLAED
QPVHGDIDLVMNLIDNHKVFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELS
TRWETVCALSVSKQTRLEQALRQAEEFHSVVHVLLEWLAEAEQALRFHGVLPDDEEALRT
LIDQHREFMKKLEEKKAELNKATGMGEAILAICHPDSITTIKHWITIIRARFEEVLAWAK
QHQQRLAGALAGLIANQELLEALLSWLQWAETTLTEKDKEVIPQEIEEVKALIAEHQTFM
EEMTRKQPDVDKVTKTYKRKALEPTPVQSHIPVLDKGRAGRKRSPTPGLYPSAAQAQIET
KNPRVNLLLREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGIL
SSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPLTDADKIEDEVTRQVA
KCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKN
DPCRVHHHGSKMLRSESNSSITTQPTIAKGRTNVELREKFILADGASQSMAAFRPRGRRS
RPSSRGASPNRSTSLSSQAGQAAAPQAVATSTPKGTPIQGSKLRLPGYLSGKGFHSGEDS
GILSTAATRVRAQFAETRRTPSRPGSRAGSKAGSRSSSRRGSDASDFDISEIQSVCSDMS
ETVPATSRPTPRAGSRPGSAKPSKIPTPQRRPIASKLDRSLKR
Download sequence
Identical sequences ENSGALP00000026214 9031.ENSGALP00000026214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]