SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000027173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000027173
Domain Number 1 Region: 241-441
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-50
Family DBL homology domain (DH-domain) 0.00000000733
Further Details:      
 
Domain Number 2 Region: 433-557
Classification Level Classification E-value
Superfamily PH domain-like 5.65e-36
Family Pleckstrin-homology domain (PH domain) 0.000013
Further Details:      
 
Domain Number 3 Region: 165-237
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-25
Family SH3-domain 0.0000385
Further Details:      
 
Domain Number 4 Region: 4-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.5e-24
Family Calponin-homology domain, CH-domain 0.00059
Further Details:      
 
Weak hits

Sequence:  9031.ENSGALP00000027173
Domain Number - Region: 739-795
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0209
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000027173
Sequence length 803
Comment (Gallus gallus)
Sequence
MTSAEQTVTWLIALGVLESPKKSIADPEGFLQSSLKDGVVLCRLLERLLPGSIEKVYPEP
RTEGECLSNIREFLRGCGASLRLETFDANDLYQGQNFSKVLSSLVALNKVTADIGLGSDS
VCARPSSHRIKSFDSLGSQSLHSRTSKLFQGQYRSLDMTDNSNHQLVVRAKFNFQQTNED
ELSFSKGDIIHVTRVEEGGWWEGTLNGKTGWFPSNYVREIKSNEKPVSPKSGTLKSPPKG
FDTSAINKSYYNVVLQNILETENEYSKELQTMLSNYLRPLQASEKLSSTNTSYLMGNLEE
ISSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMSQMKNLYLAYCANHPSAVNVLTEHSEE
LGEFMEVKGANSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRPDIQKSMTAF
KNLSAQCQEVRKRKELELQILTEAIRCWEGEDIKTLGNVIYMSQVMIQCAGSEEKNERYL
LLFPNILLMLSASPRMSGFIYQGKLPMTGMTITKLEDTENHKNAFEISGTMIERILVSCN
NQQDLHEWVDHLQKQTKVTAVGNPTIKPHSVPSHTLPSHPVTPSSKHSDSKQIPLTPAYH
TLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMK
KLLPKRKPERKPSDEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESAPQ
VLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARK
DLEKLVRKVLKNMNDPSWDETNL
Download sequence
Identical sequences ENSGALP00000027173 XP_004938599.1.86415 ENSGALP00000027173 9031.ENSGALP00000027173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]