SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9031.ENSGALP00000027398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9031.ENSGALP00000027398
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily L domain-like 1.63e-38
Family Ngr ectodomain-like 0.054
Further Details:      
 
Domain Number 2 Region: 478-591
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-28
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9031.ENSGALP00000027398
Sequence length 596
Comment (Gallus gallus)
Sequence
SDLSKNRLTEIPTELCHFVSLETLNLYHNCIKIIPDAIVNLQMLTYLNLSRNQLSSLPAC
LCGLPLKVLIASNNKLGSLPEEIGQLKQLMELDVSCNEITTLPQQIGLLKSLKELNVRRN
YLEVLPQELVQLPLVKFDFSCNKVLVIPICFRKMAQLQVLLLENNPLQSPPAQICTKGKV
HIFKYLTVQACQIKTADSLYLNAIEQPHLPQPVEESKKDSDSGVGSDNGDKRLSATEPSD
EDTISFNVPMSDIVEEDQVVKEDSGHHANSRKVEFHQGSSHLIVNDKSRETGIRFDESDA
LTTEFMSYIKSRAAECDELLRIEEDAQWQTEEIINMSEEQTIDIAMIEQLREAVDLLQDP
NRLSMDISESSDVNLYPMEPATALEFQESTVNSQMQMEMSSLGQERSLIKNDVIVWNTSG
QPSHNENKDKSPTLSPTTNNTIPFGLKPRSVFLRPQRNLESIDPQFTIRRKMEQMREERE
LVEQLRENIETRLKICLPEDLGSALMDGVVLCHLVNHIRPRSVGSIHVPSPAVPKLSMAK
CRRNVENFLDACRKLGIPEEKLCLPHHILEEKGLVKVSITVQALLDVTTVKQALFT
Download sequence
Identical sequences ENSGALP00000027397 9031.ENSGALP00000027398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]