SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9258.ENSOANP00000009674 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9258.ENSOANP00000009674
Domain Number 1 Region: 45-128
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000011
Family Snake venom toxins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9258.ENSOANP00000009674
Sequence length 169
Comment (Ornithorhynchus anatinus)
Sequence
MEPWPSLALVLLLGPLADGSKAAQSKEFTVKDIVYLHPSTTPYPGGFKCFTCEKAADNYD
CNRWAPDVYCPREARYCYTQHTMAASGNSVSVTKRCVALEDCLSTGCVDLEVEGHKVSSS
ALXGNICNCDASQRVGRHFATTSPIGRTGRQGHGLALISCLCAWLGLSS
Download sequence
Identical sequences F7CHM5
9258.ENSOANP00000009674 ENSOANP00000009674 ENSOANP00000009674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]